SecReT6
Protein ID: 479192300
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1249
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1294474..1295007 [-]
Producthypothetical protein
NoteTssB
UniProt IDI7JNF2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.10E-60, Aligned region: 12..165
Protein Sequence: 177 a.a.     [Download]
>gi|479192300|ref|YP_007822196.1| conserved hypothetical protein [Taylorella asinigenitalis 14/45]
MGSRSKSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMAVMSDLTGKSTVEQADINERKFSEIDVDN
FDDRMKAIAPRVDISVPNTLTGEGRMYVDLTFNSMDDFNPANIARNVEPLAKLLEARTELSNLLTYMDGK
SGAEQLINKVLENPALLKSLAAAPNKSSSDEAQQDQE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1295007-1294474 Taylorella asinigenitalis 14/45 draft genome
ATGGGCTCAAGAAGCAAAAGTGGTCAAAAATTTATTGCACGCAACCGTGCACCACGCGTACAAATCGAGT
ATGACGTAGAGATTTACGGTGCTGAGCGTAAAATCCAACTTCCATTTGTTATGGCAGTTATGTCTGATTT
GACTGGTAAATCAACTGTTGAGCAAGCCGATATTAATGAGCGTAAATTTAGTGAAATCGATGTAGATAAT
TTTGATGATCGCATGAAAGCTATCGCTCCTCGCGTTGATATTTCTGTTCCTAATACTCTTACAGGTGAAG
GCAGAATGTATGTTGACTTAACTTTCAACAGTATGGACGACTTTAACCCAGCAAATATTGCAAGAAACGT
TGAGCCATTAGCAAAATTATTAGAAGCTAGAACTGAGCTTTCTAATCTATTAACTTATATGGACGGTAAG
TCTGGTGCAGAACAATTAATTAATAAAGTTCTTGAAAATCCAGCTTTACTTAAATCATTAGCAGCTGCGC
CAAACAAATCTTCATCTGATGAAGCGCAACAAGATCAAGAGTAG