SecReT6
Protein ID: 479192301
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1250
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1295045..1296112 [-]
Producthypothetical protein
NoteTssA
UniProt IDI7IC68
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-13, Aligned region: 52..111
Protein Sequence: 355 a.a.     [Download]
>gi|479192301|ref|YP_007822197.1| conserved hypothetical protein [Taylorella asinigenitalis 14/45]
MMNFDELFPSFDNDDCGLNLEYDSDFLNLVQASQAKPEQQFGDAVIEAQPPDWAKVEKMALELCKRSCDV
RVLQILTYAWTFQLGLVGYARGVNLIHQALEKCWDAVNPPLVEEDGYEDPMPRVNAISALGDVSTVGRDI
RNSKLLTENYGNLTVREAEAILEGNTEGFPGGKNRLSEMLSQANQAENPIVQAIPVAFNAMKGIEDLVVE
KLGHEWRPDFQTIKSLFGSFVQLINSDISSSDSDLDSGDSSSESSRESDSLVDSGSESTAKFASWREVQI
KTRADAILALEKACAYFEVHEPSHPAPFIIRRLQQAIPLNFFDMLKNLAPSGSEQFEQTWIPRTEEETSG
SSDEY
 
Nucleotide Sequence: 1068 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1296112-1295045 Taylorella asinigenitalis 14/45 draft genome
ATGATGAATTTTGATGAGTTATTTCCCTCATTCGATAACGATGATTGTGGGTTAAATCTTGAGTATGATT
CAGATTTTTTGAATCTAGTTCAAGCCTCACAAGCTAAGCCTGAACAACAGTTCGGAGATGCCGTAATCGA
AGCCCAACCCCCTGATTGGGCCAAAGTTGAGAAAATGGCATTGGAATTATGCAAGCGATCATGTGATGTT
CGTGTGTTGCAAATTCTTACATATGCTTGGACTTTTCAACTTGGTTTAGTTGGTTATGCTCGGGGAGTTA
ACTTAATTCATCAAGCTTTGGAGAAGTGTTGGGATGCCGTTAATCCTCCTCTTGTTGAAGAAGATGGTTA
TGAAGATCCAATGCCTCGCGTTAATGCAATCTCTGCATTAGGTGATGTATCTACTGTTGGTAGGGATATT
CGTAATTCTAAGCTTCTTACCGAGAATTACGGGAATCTAACAGTTCGTGAAGCTGAAGCTATATTGGAAG
GGAATACAGAAGGATTCCCAGGCGGTAAAAACAGATTATCTGAGATGTTATCTCAAGCTAATCAAGCTGA
AAATCCTATTGTACAGGCCATTCCAGTAGCTTTTAATGCCATGAAAGGCATTGAGGATTTAGTAGTTGAA
AAGTTGGGCCATGAGTGGCGTCCAGATTTTCAAACTATTAAGTCTTTATTTGGTTCGTTTGTTCAACTAA
TTAATTCTGACATTAGTTCGAGCGATTCTGATTTAGATTCAGGCGATAGTTCATCTGAATCTTCTCGTGA
ATCGGATTCTTTAGTTGACTCGGGTTCTGAGTCTACAGCTAAGTTTGCCTCTTGGCGTGAAGTTCAGATT
AAAACTAGGGCGGATGCGATATTGGCGCTCGAAAAGGCTTGTGCTTATTTTGAAGTTCATGAGCCTAGTC
ATCCAGCGCCATTTATTATTCGTAGATTACAACAAGCGATACCTCTTAATTTCTTTGATATGCTTAAAAA
CCTTGCACCGTCAGGTTCTGAGCAGTTTGAACAAACTTGGATACCTCGCACTGAAGAGGAAACAAGTGGT
TCATCGGATGAATATTAA