SecReT6
Protein ID: 479192305
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1254
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1303362..1304699 [-]
ProductOmpA-family protein
NoteTssL
UniProt IDI7JNF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-68, Aligned region: 39..244
DUF2077 [PF09850], Evalue: 3.10E-68, Aligned region: 379..410
OmpA [PF00691], Evalue: 7.90E-19, Aligned region: 311..409
Protein Sequence: 445 a.a.     [Download]
>gi|479192305|ref|YP_007822201.1| OmpA-family protein [Taylorella asinigenitalis 14/45]
MSSRDYVDSKMGPWGQIHQQRYDESNKIRPDNFVISGSNPLVAAANPLLTLLPQIRFSQHHDNVDMLREL
LVEEVRQFEVRAQEKGISKETILGARYCLCTAIDEACAMAPWGQQGLWSGKSLLVTYHNETWGGEKFFQL
LRKLSQNPENHIDLLELMYFCLMLGFEGRFRVIENGRSQLETLKQRLLLIIKKVRGSYPITLSPNWKGDE
IINKIKRLPIPLWVVAIFGFALAVLSYILFSWLLGGKSDEVAYDIVKIKPPAMQIAVPVRVVRQEAPKRL
AQFLEAEIRENLMTVRDESDRSVVELRGDELFESGSAEIKKKFETVVNRLGDALDETEGNILITGHTDNR
PIKTIRFPSNWDLSQARADAVAKIIESRLTQKNRIRAEGKADTMPVKPNDTAENRARNRRVEITLLIPAQ
TKKARPTTPYIVPTPDGTKTINPDQ
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1304699-1303362 Taylorella asinigenitalis 14/45 draft genome
ATGTCTTCTAGAGATTATGTTGATTCTAAGATGGGGCCGTGGGGTCAAATCCACCAGCAACGTTATGATG
AATCAAACAAAATAAGACCCGATAATTTTGTAATTAGCGGTTCAAATCCACTTGTAGCAGCGGCTAATCC
GCTGCTCACCCTATTGCCACAAATCCGCTTCTCTCAACATCACGATAACGTTGATATGTTGCGTGAGTTA
CTCGTTGAGGAGGTTCGTCAATTTGAGGTTCGAGCTCAAGAAAAGGGTATTAGTAAAGAAACAATTCTTG
GAGCTAGATATTGTCTATGTACAGCTATAGACGAGGCTTGTGCAATGGCTCCTTGGGGGCAGCAAGGCTT
ATGGTCTGGTAAAAGTTTGCTTGTCACCTACCATAATGAAACATGGGGTGGAGAAAAATTCTTCCAGCTT
TTAAGAAAACTCTCTCAGAACCCAGAAAATCATATTGATCTTCTTGAACTTATGTATTTTTGTTTGATGT
TAGGTTTTGAGGGGCGTTTCAGAGTTATTGAAAATGGCCGCTCTCAACTAGAGACCTTAAAACAAAGGCT
TCTTCTTATTATTAAAAAAGTAAGGGGTTCATATCCAATTACTCTCTCTCCTAATTGGAAGGGTGACGAG
ATTATCAATAAGATTAAACGTTTACCAATTCCATTGTGGGTGGTTGCTATTTTTGGGTTTGCACTTGCAG
TATTATCGTACATTTTATTCTCTTGGTTGCTTGGCGGAAAATCAGATGAAGTTGCCTACGATATCGTAAA
AATTAAACCACCAGCTATGCAAATTGCGGTTCCAGTTAGGGTTGTTCGTCAAGAAGCACCGAAGCGTTTA
GCTCAGTTCCTAGAAGCTGAAATCCGCGAGAATTTAATGACTGTACGAGATGAATCAGACAGAAGTGTAG
TTGAACTACGCGGTGACGAATTATTTGAATCTGGTTCAGCAGAAATTAAGAAAAAATTTGAAACTGTCGT
TAACCGACTTGGTGATGCTTTAGACGAGACGGAAGGAAATATTCTGATTACAGGTCACACGGATAATAGA
CCTATCAAGACAATTAGATTCCCATCAAACTGGGACTTATCACAAGCTAGGGCAGACGCAGTTGCAAAAA
TTATTGAGTCTCGTTTGACACAGAAAAATCGTATAAGAGCTGAAGGTAAGGCTGACACTATGCCAGTTAA
ACCGAATGATACAGCCGAAAATAGGGCTAGAAATCGTCGTGTTGAAATTACATTGTTAATTCCAGCGCAG
ACTAAGAAAGCTCGTCCAACAACCCCTTATATAGTCCCAACACCTGATGGTACTAAGACTATTAATCCTG
ATCAGTAA