SecReT6
Protein ID: 479192306
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1255
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1304710..1306059 [-]
Producthypothetical protein
NoteTssK
UniProt IDI7IC69
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-118, Aligned region: 19..442
Protein Sequence: 449 a.a.     [Download]
>gi|479192306|ref|YP_007822202.1| conserved hypothetical protein [Taylorella asinigenitalis 14/45]
MSISNKVIWSEGMFLRPQHFQQQDRYLDSKQRVLLEASPTYYWGFYQLEIDQNALKENKLAITKAAGIFK
DGTPFSLNGNDVPMLPLDSFAREEMIYLVLPSKEASRQEVSYEEGSDLLARFSVVETTLSDVSDITLGEA
PVQIGKPQFKFMPDSEIDGNWVKLPVVHFKGKNKLNIVEVDTGFIQPTINCAFVNNPITDHLSRVVDLLN
LRSTELSKRFNPNNRTSASTTYETIILGIVNRNLILFKHLYTLEYLHPEVFFRYLSMLVAELAMFHPDSI
SINKIPSYDHDALKVPLENLMSQIGDALNIVFEDAYVTIPLEDKGHGLSVGKVPDKNLFAKSQFVLAVKA
DLPGESVRKTFPQQAKLGPTNRMRDLVHLQLPGITLEHMDQVPAALPYHAGYIYFNLVKEGDMWNQFEKS
STLALHLAGDYPGLDMQFWAVKNTDKRNS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1306059-1304710 Taylorella asinigenitalis 14/45 draft genome
ATGAGCATAAGTAATAAAGTAATTTGGTCTGAGGGCATGTTTCTGCGCCCTCAGCATTTTCAACAACAAG
ATAGATACCTAGATTCTAAGCAAAGAGTTCTTCTTGAAGCTTCCCCAACCTACTATTGGGGCTTTTATCA
ATTAGAGATTGATCAAAATGCACTTAAAGAAAACAAGTTAGCTATTACTAAAGCTGCAGGTATTTTTAAA
GACGGAACTCCATTCTCTTTAAACGGAAATGATGTTCCGATGCTTCCATTAGATTCTTTTGCTCGTGAAG
AGATGATTTATTTGGTTCTTCCATCTAAAGAGGCATCTCGTCAAGAAGTTTCATATGAAGAAGGAAGTGA
TTTGCTCGCTAGATTTAGCGTTGTTGAAACTACTTTAAGTGACGTATCTGATATTACTTTAGGTGAGGCA
CCAGTTCAAATTGGTAAGCCTCAGTTTAAATTTATGCCTGATTCAGAAATTGACGGAAATTGGGTAAAAC
TTCCTGTAGTGCATTTTAAAGGTAAAAATAAACTTAATATTGTTGAAGTTGATACTGGGTTTATCCAACC
GACAATAAATTGTGCTTTCGTAAATAATCCAATTACCGATCATTTATCAAGAGTTGTGGATTTACTAAAC
CTAAGATCTACAGAACTTTCAAAACGGTTTAACCCTAATAATAGAACTTCAGCTAGTACAACTTATGAGA
CTATTATTTTAGGTATTGTAAATAGAAACCTAATTCTATTTAAACATCTATATACACTTGAATATCTGCA
TCCTGAAGTATTTTTTAGATATTTATCTATGCTTGTGGCTGAGCTTGCTATGTTCCATCCAGATAGCATC
TCTATAAATAAAATTCCTTCATATGACCATGATGCTTTAAAAGTGCCTCTAGAAAATTTGATGAGCCAAA
TCGGCGATGCACTTAATATCGTATTCGAAGATGCTTACGTTACTATCCCACTCGAAGACAAAGGTCATGG
ACTTAGTGTCGGGAAAGTTCCAGATAAAAATCTATTCGCAAAATCACAATTTGTACTTGCGGTCAAAGCC
GATTTGCCAGGGGAGTCTGTACGCAAAACATTCCCTCAACAGGCGAAATTGGGACCTACAAACCGTATGC
GAGATCTTGTACATCTACAACTGCCTGGCATTACGCTTGAGCATATGGATCAAGTTCCGGCAGCATTGCC
ATATCATGCAGGATATATCTACTTTAATTTAGTTAAAGAAGGCGATATGTGGAATCAATTTGAAAAATCA
TCAACACTAGCCCTTCATCTAGCAGGGGATTATCCAGGCCTTGATATGCAATTCTGGGCTGTAAAAAACA
CTGATAAACGTAATTCTTAG