SecReT6
Protein ID: 479192307
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1256
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1306072..1306581 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDI7JS39
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.30E-33, Aligned region: 15..156
Protein Sequence: 169 a.a.     [Download]
>gi|479192307|ref|YP_007822203.1| putative lipoprotein [Taylorella asinigenitalis 14/45]
MKNLLRIFLVSLFATFVVACASTEKKLAVPYVVELSAATDSNPSNGRPSPIKIAVYELSSSDAFNQADFF
TLQQDYRKVLGDQVLGVKSEILSPGQTKELKFSGNLNSKHIGVIGYYKDFNSAKWKLLVDLPEAKTTNIY
KVWQRSPKSARIRIEAGAKELRVLPPVKK
 
Nucleotide Sequence: 510 bp     [Download]
>gi|479191087|ref|NC_021033.1|:c1306581-1306072 Taylorella asinigenitalis 14/45 draft genome
ATGAAAAATTTGTTACGGATATTCTTAGTTTCTTTATTTGCCACTTTTGTTGTGGCATGTGCATCTACAG
AGAAAAAACTAGCTGTGCCTTATGTTGTTGAATTATCTGCTGCAACTGATTCTAATCCTAGCAACGGAAG
ACCATCTCCTATCAAAATCGCTGTATACGAACTATCTAGTTCAGATGCATTTAATCAAGCCGACTTTTTT
ACTCTTCAACAAGACTATAGAAAAGTTTTAGGAGATCAAGTTTTAGGTGTTAAATCTGAAATTCTTTCTC
CAGGTCAAACAAAGGAACTTAAATTTTCTGGAAATCTAAATAGTAAACATATTGGTGTGATTGGCTATTA
CAAAGATTTCAACTCAGCAAAATGGAAATTATTAGTTGATCTACCAGAAGCTAAAACTACAAATATCTAC
AAAGTTTGGCAGCGTTCTCCAAAAAGTGCTCGCATTAGAATCGAAGCGGGTGCAAAAGAATTACGTGTAT
TGCCACCTGTAAAAAAATAA