SecReT6
Protein ID: 479192311
SecReT6 ID749
T6SS typei3
Gene symbol-
Locus tagKUM_1260
StrainTaylorella asinigenitalis 14/45
Repliconchromosome [GenBank: NC_021033] [Browse all T6SS(s) in this replicon]
Location [Strand]1313014..1314297 [+]
Producthypothetical protein
NoteTssG
UniProt IDI7IC70
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.00E-100, Aligned region: 20..317
Protein Sequence: 427 a.a.     [Download]
>gi|479192311|ref|YP_007822207.1| conserved hypothetical protein [Taylorella asinigenitalis 14/45]
MNKRVSKLPPDYWLNLAEYPYDHSFYQVMRYLDAKLQLRKPIGRNISPTQEPFRMRQEPSMIFAPSNLTR
VDIHDNGRPPTISILGFGLWGPNGPLPLHLTEYAKERIYHHRDKTLSAFSDIFHHRLITLFYRAWADAQN
TVGMDLPNSPFKKYVGSFIGLGNRKAILNDSIPDSAKLYFAGHLLRQTRNPEGLIQILRRYFDVPVRIKE
YIPQWIFIDKSERSTLNGTVALGENCIIGAQVKDVQHKFRIQIGPIDRKKFESFFPGTKNAKQLIEWVRL
YIGYELAWDVQLILLDKYRGQTRLGKNALLGLSSFSGKNERKTDDFDELFIDYEARDRNKRHQDAIISTL
FQSDSEDEGEGEGEGIGVGLGASNPKSVSKPKNESGSEDKSENKDKGETKSASDPDSKGNGDSTSESEKN
EDSQAKP
 
Nucleotide Sequence: 1284 bp     [Download]
>gi|479191087|ref|NC_021033.1|:1313014-1314297 Taylorella asinigenitalis 14/45 draft genome
ATGAATAAGAGAGTATCAAAACTTCCACCTGACTATTGGTTAAATTTAGCTGAGTATCCTTATGATCACA
GCTTTTACCAAGTCATGCGCTATTTAGATGCGAAATTGCAGCTGCGCAAACCAATCGGCAGAAATATTTC
TCCTACACAAGAGCCGTTCCGCATGAGGCAGGAACCGTCTATGATATTTGCACCTTCGAATTTAACTCGA
GTGGATATTCACGATAACGGCCGTCCTCCTACCATTTCGATTTTAGGCTTTGGTTTATGGGGTCCAAACG
GTCCTCTCCCGCTTCATCTCACTGAATATGCAAAAGAGCGTATTTACCATCATCGCGATAAGACATTATC
TGCATTCTCTGATATTTTCCATCATCGCTTAATCACTCTTTTTTATAGAGCTTGGGCGGATGCTCAAAAC
ACTGTAGGCATGGACCTACCAAATTCGCCTTTCAAAAAATATGTCGGTAGTTTTATTGGTTTAGGAAACC
GTAAAGCCATTCTTAACGACTCGATTCCTGATAGTGCGAAGCTATATTTTGCGGGCCATTTACTTAGACA
GACTCGCAATCCAGAGGGGCTTATACAAATTCTACGTCGCTATTTTGATGTGCCTGTTCGAATTAAGGAA
TATATCCCTCAATGGATCTTTATTGATAAAAGTGAACGTTCAACATTGAATGGTACAGTCGCATTAGGGG
AAAATTGTATTATCGGTGCTCAAGTAAAAGATGTGCAGCATAAGTTCCGTATTCAAATCGGGCCAATTGA
TCGCAAAAAATTTGAATCTTTTTTTCCAGGCACGAAAAACGCTAAGCAACTTATAGAATGGGTTAGGCTT
TATATTGGATATGAATTAGCTTGGGATGTGCAGCTGATATTGCTTGATAAATACCGTGGACAAACCCGCT
TAGGTAAAAATGCACTGCTTGGGCTTTCAAGCTTTTCGGGTAAAAATGAGCGAAAAACTGATGACTTTGA
TGAGCTGTTTATCGATTATGAAGCCCGTGACAGAAACAAGCGACATCAGGATGCAATTATTAGCACGCTT
TTTCAGTCTGATTCCGAGGATGAGGGCGAGGGCGAGGGCGAAGGGATAGGTGTAGGGCTAGGTGCTTCAA
ATCCTAAGTCTGTGTCTAAGCCTAAGAACGAATCCGGCTCCGAAGACAAATCCGAAAACAAAGACAAAGG
CGAAACCAAATCCGCCTCTGACCCCGACTCCAAAGGCAATGGCGATTCTACTTCCGAATCAGAGAAGAAC
GAAGACTCTCAAGCGAAACCCTAG