SecReT6
Protein ID: 479197081
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1092
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1177478..1178581 [-]
Producthypothetical protein
NoteTssG
UniProt IDI7IJH6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.80E-100, Aligned region: 22..319
Protein Sequence: 367 a.a.     [Download]
>gi|479197081|ref|YP_007826450.1| conserved hypothetical protein [Taylorella equigenitalis 14/56]
MTMTKKVSKLPPDYWVNLAEYPYDHSFYQVLRYLDAKHQLRKPIGRNTSPSHEPFRMRQEPSMIFAPSNL
TRVDIHDNGRPPTISILGFGLWGPNGPLPLHLTEYAKERIYHHRDKTLSAFTDIFHHRLITLFYRAWADA
QNTVGLDLPNSPFKKYIGSFIGLGIPKALNNDSISDSAKLYFSSHLLRQTRNPEGLTQMLRKYFEVPVNI
LEFIPQWIFIEKNERSTLNGTVQLGVNCIIGTQVRDVQHKFRIQIGPVNRAKFESFFPGTKNAKQLIEWV
RLYVGYEFAWDVQLILLDEFRGQTRLGRNALLGLSSFSGKNTKKTNDFDELFIDYEARDRNKRHQDALIS
TMFVSDSDESEAPQATL
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|479196022|ref|NC_021036.1|:c1178581-1177478 Taylorella equigenitalis 14/56 draft genome
ATGACTATGACTAAGAAAGTTTCTAAACTTCCACCAGATTATTGGGTGAATCTAGCTGAGTATCCATACG
ATCACAGCTTCTACCAAGTATTACGTTATTTAGATGCCAAGCATCAATTGCGTAAACCTATAGGTCGCAA
TACGTCGCCTTCGCATGAGCCGTTCCGCATGAGGCAGGAACCGTCAATGATATTTGCACCTTCAAATCTA
ACGCGGGTAGATATTCACGATAACGGAAGACCTCCCACTATTTCAATTTTAGGCTTCGGCTTGTGGGGTC
CTAACGGTCCACTTCCTCTTCATCTCACAGAGTACGCAAAAGAGCGCATATATCATCATCGCGATAAAAC
TTTATCGGCGTTTACGGACATATTTCATCATCGCCTAATTACGCTTTTTTATCGTGCTTGGGCTGATGCA
CAAAATACTGTCGGCCTGGATTTACCTAATTCACCTTTTAAAAAATACATTGGAAGTTTTATTGGACTGG
GCATACCAAAGGCATTAAATAACGACTCCATTTCCGATAGTGCGAAATTATATTTTTCAAGCCATCTTTT
AAGACAGACACGAAATCCTGAAGGTCTTACGCAAATGCTTAGAAAGTATTTTGAAGTACCTGTAAATATT
CTAGAGTTTATTCCTCAATGGATTTTTATCGAGAAAAATGAACGCTCAACTTTAAACGGCACTGTTCAAC
TGGGCGTAAATTGCATTATCGGCACTCAGGTTCGTGATGTTCAGCATAAGTTCAGAATACAAATTGGTCC
TGTTAATCGTGCAAAATTCGAATCCTTTTTCCCTGGCACAAAAAATGCTAAGCAACTCATAGAGTGGGTT
CGCCTTTATGTAGGTTATGAATTTGCATGGGATGTTCAGCTGATATTACTTGATGAATTCAGAGGGCAGA
CACGCTTAGGAAGAAATGCACTTCTTGGATTGTCTAGTTTCTCAGGCAAAAACACTAAAAAAACAAATGA
CTTTGATGAACTGTTTATAGACTACGAAGCACGTGATAGAAATAAACGCCATCAGGATGCACTCATAAGC
ACTATGTTTGTTTCCGATTCAGATGAGAGCGAAGCCCCTCAAGCGACACTCTAG