SecReT6
Protein ID: 479197082
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1093
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1178725..1181550 [+]
ProductType VI secretion ClpV1 ATPase
NoteTssH
UniProt IDI7JKD4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.20E-40, Aligned region: 228..307
AAA_2 [PF07724], Evalue: 4.20E-40, Aligned region: 545..590
AAA_2 [PF07724], Evalue: 4.20E-40, Aligned region: 668..834
AAA [PF00004], Evalue: 3.80E-21, Aligned region: 229..361
AAA [PF00004], Evalue: 3.80E-21, Aligned region: 674..758
ClpB_D2-small [PF10431], Evalue: 3.70E-17, Aligned region: 210..223
ClpB_D2-small [PF10431], Evalue: 3.70E-17, Aligned region: 575..592
ClpB_D2-small [PF10431], Evalue: 3.70E-17, Aligned region: 841..919
AAA_5 [PF07728], Evalue: 4.00E-13, Aligned region: 229..252
AAA_5 [PF07728], Evalue: 4.00E-13, Aligned region: 354..396
AAA_5 [PF07728], Evalue: 4.00E-13, Aligned region: 673..791
AAA_16 [PF13191], Evalue: 5.00E-13, Aligned region: 206..250
AAA_16 [PF13191], Evalue: 5.00E-13, Aligned region: 274..308
AAA_16 [PF13191], Evalue: 5.00E-13, Aligned region: 528..528
AAA_16 [PF13191], Evalue: 5.00E-13, Aligned region: 664..718
AAA_16 [PF13191], Evalue: 5.00E-13, Aligned region: 813..852
AAA_22 [PF13401], Evalue: 2.70E-08, Aligned region: 181..194
AAA_22 [PF13401], Evalue: 2.70E-08, Aligned region: 229..309
AAA_22 [PF13401], Evalue: 2.70E-08, Aligned region: 370..395
AAA_22 [PF13401], Evalue: 2.70E-08, Aligned region: 672..696
AAA_22 [PF13401], Evalue: 2.70E-08, Aligned region: 735..758
Sigma54_activat [PF00158], Evalue: 8.10E-08, Aligned region: 223..245
Sigma54_activat [PF00158], Evalue: 8.10E-08, Aligned region: 671..787
AAA_14 [PF13173], Evalue: 1.00E-07, Aligned region: 180..202
AAA_14 [PF13173], Evalue: 1.00E-07, Aligned region: 229..309
AAA_14 [PF13173], Evalue: 1.00E-07, Aligned region: 335..395
AAA_14 [PF13173], Evalue: 1.00E-07, Aligned region: 672..761
AAA_19 [PF13245], Evalue: 3.30E-07, Aligned region: 227..251
AAA_19 [PF13245], Evalue: 3.30E-07, Aligned region: 671..695
NACHT [PF05729], Evalue: 4.70E-06, Aligned region: 229..266
NACHT [PF05729], Evalue: 4.70E-06, Aligned region: 673..700
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 211..253
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 282..326
AAA_25 [PF13481], Evalue: 1.00E-05, Aligned region: 670..699
AAA_29 [PF13555], Evalue: 3.80E-05, Aligned region: 221..245
AAA_29 [PF13555], Evalue: 3.80E-05, Aligned region: 671..697
AAA_17 [PF13207], Evalue: 5.20E-05, Aligned region: 229..249
AAA_17 [PF13207], Evalue: 5.20E-05, Aligned region: 468..494
AAA_17 [PF13207], Evalue: 5.20E-05, Aligned region: 672..709
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 213..250
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 673..693
IstB_IS21 [PF01695], Evalue: 5.50E-05, Aligned region: 783..806
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 228..250
Zeta_toxin [PF06414], Evalue: 0.00014, Aligned region: 663..713
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 179..195
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 208..249
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 281..313
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 546..587
Arch_ATPase [PF01637], Evalue: 0.00036, Aligned region: 672..694
NTPase_1 [PF03266], Evalue: 0.00067, Aligned region: 229..251
NTPase_1 [PF03266], Evalue: 0.00067, Aligned region: 280..306
NTPase_1 [PF03266], Evalue: 0.00067, Aligned region: 673..694
Hpr_kinase_C [PF07475], Evalue: 0.0023, Aligned region: 229..240
Hpr_kinase_C [PF07475], Evalue: 0.0023, Aligned region: 671..692
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 179..200
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 230..251
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 674..695
RNA_helicase [PF00910], Evalue: 0.0027, Aligned region: 772..792
T2SE [PF00437], Evalue: 0.0035, Aligned region: 214..243
T2SE [PF00437], Evalue: 0.0035, Aligned region: 668..742
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 220..304
DUF815 [PF05673], Evalue: 0.0039, Aligned region: 645..714
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 181..194
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 229..255
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 461..509
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 551..602
AAA_18 [PF13238], Evalue: 0.0042, Aligned region: 674..702
AAA_28 [PF13521], Evalue: 0.0048, Aligned region: 230..304
AAA_28 [PF13521], Evalue: 0.0048, Aligned region: 673..693
DUF607 [PF04678], Evalue: 0.0099, Aligned region: 30..70
DUF607 [PF04678], Evalue: 0.0099, Aligned region: 411..493
DUF607 [PF04678], Evalue: 0.0099, Aligned region: 561..588
Protein Sequence: 941 a.a.     [Download]
>gi|479197082|ref|YP_007826451.1| Type VI secretion ClpV1 ATPase [Taylorella equigenitalis 14/56]
MSDINRTDLFGKLNTLLYRSLEGATSFCKLRGNSFVELVHWIHQILHEHDSDLQKIIRHFDLRIETVERD
VVASLDELPRGASSVSDLSEHIDSATERAWVYGSLKYGDARIRSGYLILGILKTNSLRSVLYGISSEFKK
ITPDVLAENLIDIVKNSAEEKDSVGLGQASTGASASASPQNSGKSALAQYAVDLTAKARNKEIDPVSGRD
EEIRQIVDILMRRRQNNPLLTGEAGVGKTAVVEGFALRLAKGDVPETLRDVTLYLLDIGLLQAGASMKGE
FESRLRSVIDEVQSSEKPIVLFIDEIHTLVGAGGAQGTGDAANLLKPALARGQLRTIGATTWAEYKKYIE
KDPALTRRFQTVQVHEPNEEKALIMLRGISEPLENHHKVLLLDEAIEAAVRLSHRYIPARQLPDKAIALL
DTACARVAVSQYAEPAALEDTRRTIEYLNTEREIALREQKLGHDKSERLEEIEKELDTLEERQKELDAKW
SEEKELIKKIFELRKIIQENTDLSRKKSKSIPTEPAKNPELQADSLSEEASQPTEATQAEEEPKEHVSED
SKEAPKSKKLSEKELDEVRKELRDVQQKLLEKQGEYPLIFPSVDGNAVASVVADWTGIPVGRMVKNEANS
ILTLADTLEKRVIGQRHGLETIVKRIQTSRAKLTDPNKPVGVFLLTGPSGVGKTETALALAESLYGGEQN
LITINMSEFQEAHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGF
MEDGEGRYIDFKNTVIILTSNVGTDRIVDLCKDPELMPDVDGLTNALREPLLKTFPAALLGRLVVVPYFP
LSDEMLGNIVKLQLRRIEKRLKENHNIDFKVTDEAIKLIVSRCTQVESGGRMVDAILTNTVLPNVSHKIL
EGTTSGQTITSLSLDAKDGEFVYDYTEVPNK
 
Nucleotide Sequence: 2826 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1178725-1181550 Taylorella equigenitalis 14/56 draft genome
ATGTCTGATATCAATCGTACCGACCTCTTTGGCAAACTTAATACTTTGCTTTACCGTTCTCTTGAGGGTG
CTACTTCATTTTGCAAACTTCGCGGAAATTCATTTGTTGAACTTGTGCATTGGATTCATCAAATTCTTCA
TGAACATGATAGTGATTTGCAAAAAATTATTCGCCATTTTGACTTGCGAATCGAAACCGTTGAGCGTGAT
GTTGTAGCATCGCTTGATGAATTACCTCGTGGTGCAAGCTCTGTTTCAGATTTATCAGAGCATATTGATA
GTGCTACTGAACGTGCGTGGGTTTATGGATCTCTAAAATATGGAGATGCTCGCATTCGCAGTGGGTACTT
GATATTGGGTATATTGAAAACAAATTCTTTACGTTCAGTACTATACGGTATCAGTTCTGAATTTAAAAAA
ATTACACCAGATGTGCTTGCAGAAAATCTAATCGATATTGTTAAAAATTCGGCTGAAGAGAAAGATTCAG
TTGGATTAGGTCAAGCATCGACTGGAGCTTCAGCCTCAGCATCGCCTCAAAATTCTGGAAAATCTGCATT
AGCTCAATATGCTGTTGACCTTACAGCAAAAGCTCGCAATAAGGAAATCGACCCTGTTTCTGGTCGTGAT
GAGGAGATTCGTCAAATTGTAGATATTTTGATGAGACGTCGTCAAAATAACCCACTACTTACTGGTGAAG
CGGGTGTAGGTAAAACAGCAGTCGTTGAGGGATTTGCACTACGCCTTGCTAAAGGTGATGTACCAGAGAC
TTTGCGTGATGTAACTTTATACCTACTTGATATTGGCTTGCTTCAAGCAGGGGCAAGCATGAAAGGTGAG
TTCGAATCTCGTTTAAGATCTGTGATCGATGAGGTTCAATCAAGTGAAAAACCTATAGTTTTATTTATAG
ACGAAATCCATACACTTGTAGGGGCTGGTGGTGCTCAGGGAACTGGGGATGCAGCTAACCTTTTAAAACC
AGCTCTAGCACGTGGTCAGCTAAGAACTATCGGTGCTACAACTTGGGCTGAATATAAAAAATATATCGAA
AAAGACCCAGCATTGACACGACGCTTTCAAACAGTTCAAGTCCACGAGCCAAATGAAGAAAAAGCATTAA
TCATGTTGCGTGGTATCTCTGAACCATTAGAAAATCACCACAAAGTTCTTCTTCTAGATGAAGCAATCGA
AGCTGCGGTGAGACTATCACATAGATATATTCCAGCTAGACAATTGCCAGACAAAGCCATTGCCCTCCTA
GATACGGCATGTGCACGTGTGGCTGTTAGCCAATATGCTGAGCCTGCAGCTTTAGAAGATACACGTAGAA
CCATAGAGTATTTAAACACAGAGCGTGAAATTGCATTACGTGAACAAAAACTTGGTCACGATAAATCTGA
ACGCCTCGAAGAAATCGAGAAAGAGCTTGATACACTTGAAGAGCGTCAAAAAGAATTAGATGCAAAATGG
AGCGAAGAGAAAGAGCTAATTAAGAAAATCTTTGAACTTCGCAAAATTATCCAAGAAAATACAGACCTTT
CTCGTAAAAAATCGAAAAGTATCCCTACAGAACCTGCTAAAAATCCTGAACTTCAAGCGGACTCCTTATC
TGAAGAAGCATCTCAACCTACAGAAGCAACACAAGCCGAAGAAGAGCCTAAGGAACATGTTAGTGAGGAT
TCAAAAGAAGCACCTAAGTCTAAAAAACTTTCCGAGAAAGAGCTTGATGAAGTACGCAAAGAACTCCGTG
ATGTACAACAAAAACTACTAGAAAAACAAGGCGAATATCCATTGATTTTCCCTTCTGTGGATGGCAATGC
AGTAGCCTCTGTAGTTGCTGACTGGACAGGCATCCCAGTTGGTCGCATGGTCAAAAACGAAGCTAATTCT
ATCCTTACATTAGCCGATACGCTTGAAAAACGTGTTATCGGACAACGTCACGGTTTAGAAACTATTGTTA
AACGTATTCAAACTTCACGTGCAAAACTTACCGACCCTAACAAACCAGTGGGTGTATTCCTACTAACTGG
CCCATCAGGTGTTGGTAAAACTGAGACAGCTCTTGCTCTTGCAGAATCTTTATACGGTGGTGAGCAAAAT
CTTATCACTATCAACATGTCAGAGTTCCAAGAAGCTCACACTGTGTCTACATTAAAAGGTGCACCTCCAG
GGTATGTAGGCTATGGTGAGGGCGGTGTGTTGACAGAGGCGGTTCGTCGTCGTCCATACAGTGTAGTGTT
ACTTGATGAAGTTGAGAAAGCCCACCCTGACGTTCATGAAATCTTCTTCCAAGTTTTTGATAAAGGTTTT
ATGGAAGACGGAGAAGGTCGATATATCGACTTCAAAAATACAGTAATTATCCTTACTTCGAACGTAGGCA
CAGACCGTATTGTGGATTTGTGTAAGGACCCTGAGCTAATGCCTGATGTTGATGGCTTGACAAATGCACT
TCGTGAGCCATTACTTAAAACATTCCCAGCGGCATTGCTAGGACGTTTAGTTGTTGTTCCATATTTCCCT
CTATCGGATGAAATGTTGGGCAATATTGTCAAACTACAATTGCGTCGTATTGAGAAACGTCTTAAAGAAA
ACCACAATATCGACTTTAAAGTTACCGATGAAGCTATCAAGCTTATCGTTAGCCGTTGTACACAGGTTGA
GTCTGGCGGTCGTATGGTAGATGCAATTCTTACTAATACAGTATTGCCAAACGTATCACACAAAATACTT
GAGGGTACGACTAGTGGCCAAACAATTACTTCACTTTCGCTTGATGCAAAAGATGGAGAATTTGTATACG
ACTATACAGAAGTGCCTAATAAATAG