SecReT6
Protein ID: 479197085
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1096
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1185172..1185681 [+]
Productputative lipoprotein
NoteTssJ
UniProt IDI7IZI8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-33, Aligned region: 16..155
Protein Sequence: 169 a.a.     [Download]
>gi|479197085|ref|YP_007826454.1| putative lipoprotein [Taylorella equigenitalis 14/56]
MKNLFKLVLLSLVATIVVACASTEKKLAVPYIVEISASPDSNQSNGRPSPIKVVVYELSSSDAFNQADFF
TLQQDYRKVLGDQVLGVKSVILSPGETKELKFSGSLNSKHIGVIGYYKEFNSSKWRLLVDLPEAKSTNIY
KFWQRSPKSARIRIQAGAKELVVLPPETK
 
Nucleotide Sequence: 510 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1185172-1185681 Taylorella equigenitalis 14/56 draft genome
ATGAAGAATTTATTTAAACTGGTGCTTTTATCACTTGTTGCTACTATTGTGGTGGCATGTGCTTCTACAG
AGAAAAAATTGGCTGTTCCATATATAGTTGAGATTTCAGCTTCTCCAGATTCTAATCAAAGCAACGGTCG
TCCTTCACCAATTAAAGTTGTTGTTTATGAATTATCTAGTTCTGATGCATTTAATCAAGCAGACTTTTTT
ACTCTACAACAAGACTACAGAAAAGTACTTGGTGACCAAGTTCTTGGAGTTAAATCAGTAATACTTTCTC
CAGGTGAAACTAAAGAACTTAAGTTCTCTGGTAGCTTAAACAGCAAACATATCGGTGTTATCGGCTACTA
TAAAGAATTTAATTCCTCTAAATGGAGATTATTAGTTGATCTTCCTGAAGCTAAATCTACAAACATTTAT
AAATTCTGGCAGCGTTCCCCTAAAAGTGCACGTATTAGAATTCAAGCCGGAGCGAAGGAACTTGTAGTAT
TGCCACCAGAAACAAAATAA