SecReT6
Protein ID: 479197086
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1097
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1185694..1187046 [+]
Producthypothetical protein
NoteTssK
UniProt IDI7IJH8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-116, Aligned region: 19..442
Protein Sequence: 450 a.a.     [Download]
>gi|479197086|ref|YP_007826455.1| conserved hypothetical protein [Taylorella equigenitalis 14/56]
MSIESKVIWTEGMFLRPQHFQQQDRYLDSKQKVLLEASSTYFWGFSQLEIDQNALKENKLSILKASGIFK
DGTAFSLGPNEVPMLPLDTLTREETIYLVLPSREASRQEVSYDEGSDLLARFSVVETTLSDVSDITLGEA
PVQIGKPKFRFMPDSEIDGSWIKLPLVHYKGKNKLNIVEVDSGFIQPTLNCTFVDNPITNHLSKVVELLN
LRSTELSKRFNPNNRTSASTTYETIILGIVNRNLILFRHLYTLEYLHPEVFFRYLSMLVAELAMFHPDSI
AINKIPSYDHDALKVPLENLMSQIGDALNIVFEDAYVSIPLEDKGHGLSVGKVPDKSLFAKSQFVLAVKA
DLPGESVRKTFPQQAKLGPTNRMRDLVHLQLPGITLEHMDQVPAALPYHAGYIYFNLVKDGDMWNQFEKS
STLALHLAGEYPGLDMLFWAVKNTDKRNSK
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1185694-1187046 Taylorella equigenitalis 14/56 draft genome
ATGAGCATAGAAAGTAAAGTTATATGGACTGAGGGCATGTTCTTGCGCCCTCAGCATTTTCAACAGCAAG
ATAGATATTTAGATTCAAAGCAGAAGGTGCTTCTTGAGGCATCTTCAACTTATTTTTGGGGTTTCTCTCA
GTTAGAAATTGACCAAAACGCACTTAAGGAAAATAAACTTTCAATATTAAAGGCTTCAGGTATTTTTAAG
GATGGGACAGCTTTTTCTTTGGGACCTAATGAGGTTCCTATGCTACCTTTAGATACTTTAACTAGAGAGG
AAACTATTTATTTAGTTTTACCTTCAAGAGAGGCTTCACGTCAGGAAGTTTCTTATGACGAAGGTAGCGA
TTTATTAGCTAGATTTAGTGTTGTTGAGACTACTCTATCCGATGTTTCCGATATAACTTTAGGTGAAGCA
CCTGTTCAAATAGGTAAGCCAAAATTTAGGTTTATGCCTGATTCTGAAATCGATGGAAGTTGGATTAAGC
TTCCACTTGTTCATTACAAAGGCAAAAATAAATTAAATATAGTTGAAGTTGATAGTGGATTTATCCAACC
AACTTTAAATTGTACGTTTGTTGATAATCCTATTACCAATCATCTTTCAAAAGTAGTGGAATTATTAAAT
CTTAGGTCTACTGAGCTTTCTAAGCGCTTTAATCCTAACAATAGAACTTCGGCTAGTACTACTTACGAAA
CAATTATTCTTGGTATCGTTAATAGAAATTTAATTTTATTTAGACACTTATATACGCTTGAGTATCTGCA
CCCAGAGGTGTTCTTCAGATACTTATCTATGTTGGTAGCAGAACTTGCAATGTTCCATCCAGATAGCATT
GCCATAAATAAAATCCCTTCTTATGACCACGACGCATTAAAAGTTCCACTTGAAAATCTTATGAGTCAGA
TAGGTGATGCACTTAATATCGTATTTGAAGATGCATACGTATCTATACCGCTTGAAGATAAAGGGCATGG
TCTTAGTGTGGGTAAAGTACCAGACAAAAGCCTTTTTGCAAAATCGCAATTTGTACTTGCTGTCAAAGCG
GATTTGCCAGGAGAGTCTGTACGCAAGACATTCCCTCAACAAGCAAAACTTGGACCTACAAATCGTATGC
GCGATCTTGTACATTTACAACTTCCAGGTATTACGCTTGAGCATATGGATCAAGTTCCTGCAGCATTGCC
ATACCATGCGGGTTATATCTACTTTAACCTAGTAAAAGATGGAGATATGTGGAATCAATTTGAAAAATCT
TCAACATTGGCACTGCATTTGGCGGGTGAATATCCTGGACTTGATATGTTATTCTGGGCTGTTAAAAACA
CTGACAAACGTAATTCGAAGTGA