SecReT6
Protein ID: 479197087
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1098
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1187054..1188391 [+]
ProductOmpA-family protein
NoteTssL
UniProt IDI7JKD8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.00E-70, Aligned region: 39..244
OmpA [PF00691], Evalue: 1.20E-18, Aligned region: 311..409
Protein Sequence: 445 a.a.     [Download]
>gi|479197087|ref|YP_007826456.1| OmpA-family protein [Taylorella equigenitalis 14/56]
MSSRDYVDSKMGPWGQIHQQRYDDSNKIRPDNFVISGSNPLVAAANPLLTLLPQIRFSQHHDNVDMLREL
LVEEVRQFEVRAQEKGISKETILGARYCLCTAIDEACAMAPWGQQGLWSGKSLLVTYHNETWGGEKFFQL
LRKLSQNPENHIDLLELMYFCLMLGFEGRFRVIENGRSQLETLKQRLLLIIKKVRGAYPDTLSPHWKGDE
IINKIKRLPIPLWVVAVFGFALAVLAYILFSWLLGGKSDDVAYDIVKIKPPAMQIAVPVRVVRTEGPKRL
AQYLESEIRENLLTVRDESDRSVVELRGDEFFESGSADIKKQFESVVNRLGDALDETEGNILITGHTDNR
PIKTIRFPSNWDLSQARADAVAKIIESRLTQPNRIRSEGKADTMPVTSNDTPENRKRNRRVEITLLIPAQ
SKKSRPTTPFIVPTPEGTKTINPDN
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1187054-1188391 Taylorella equigenitalis 14/56 draft genome
ATGTCTTCTAGAGATTATGTAGATTCGAAGATGGGGCCTTGGGGGCAGATACACCAACAGCGCTACGATG
ATTCAAATAAAATTAGACCCGATAATTTTGTAATTAGTGGTTCCAACCCTTTGGTTGCGGCCGCTAATCC
ATTATTGACACTGCTACCACAAATTAGGTTCTCACAGCATCACGATAATGTGGATATGTTACGTGAATTG
TTGGTTGAAGAAGTTAGACAATTTGAAGTTAGGGCTCAAGAAAAGGGAATTAGTAAGGAGACTATTCTAG
GTGCTAGGTACTGTTTATGTACCGCAATAGATGAAGCTTGTGCCATGGCTCCTTGGGGGCAACAGGGATT
GTGGTCTGGTAAAAGCTTGTTAGTTACCTATCATAACGAAACATGGGGTGGTGAGAAGTTTTTCCAACTA
CTTCGTAAGCTTTCTCAAAATCCAGAAAATCATATTGATCTTCTAGAACTTATGTATTTCTGTTTGATGC
TTGGATTTGAAGGAAGATTCAGAGTTATTGAAAATGGACGTTCGCAATTAGAAACCCTGAAACAGCGCCT
GTTGCTTATTATTAAAAAAGTTAGGGGTGCCTATCCTGACACTCTTTCTCCGCATTGGAAGGGAGATGAG
ATTATAAATAAGATTAAACGCCTTCCAATTCCACTATGGGTTGTTGCAGTGTTTGGATTTGCATTAGCGG
TTTTAGCATATATATTATTTTCATGGCTACTCGGCGGAAAGTCAGATGATGTCGCATATGACATAGTTAA
GATCAAACCACCTGCTATGCAGATTGCTGTACCCGTTCGTGTTGTTAGAACTGAAGGACCTAAACGACTA
GCCCAATATCTTGAATCTGAAATCAGAGAAAACTTGCTTACTGTACGCGATGAGTCTGACCGAAGTGTCG
TGGAACTAAGGGGAGATGAATTCTTCGAATCAGGTTCTGCAGATATTAAAAAACAATTTGAATCTGTAGT
TAATCGTTTGGGCGATGCACTAGATGAAACAGAAGGTAATATTCTTATTACTGGACACACAGATAATAGA
CCTATCAAAACGATTCGATTCCCTTCAAACTGGGATCTATCACAAGCTAGGGCTGATGCCGTAGCTAAAA
TTATTGAATCTCGTTTGACACAACCTAATCGTATTAGGTCTGAAGGTAAAGCGGACACCATGCCTGTTAC
CTCTAACGATACACCAGAAAATAGAAAACGAAATCGTAGGGTTGAAATCACATTATTGATTCCTGCGCAA
TCTAAAAAATCCCGTCCGACCACTCCGTTTATAGTTCCAACACCTGAGGGTACAAAAACTATAAATCCAG
ATAATTAG