SecReT6
Protein ID: 479197094
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1105
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1197226..1198287 [+]
Producthypothetical protein
NoteTssA
UniProt IDI7JQ51
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.60E-14, Aligned region: 52..111
Protein Sequence: 353 a.a.     [Download]
>gi|479197094|ref|YP_007826463.1| conserved hypothetical protein [Taylorella equigenitalis 14/56]
MMNFDELFPSFDNDDCGANLEYDSDFLNLVQASVPKPEQQFGDAVIEAQPPDWAKVEKMALELCKRSCDV
RILQILTYAWTFQRGLVGYAQGIDLVHQALEKCWDSINPPLFEEDGYEDPMPRVNAISALGDLSTLGRGI
RSSKLLSDNYGNLTVREGEAIIDGSNDGFPGGKNRLSELLSQATQSENEIALAIPVAFNALQSIEDLVVE
KLGHDWRPDFPTIKSLFGSFVHLINSRPSTSSSEAVVESTEISESSTQSSDTSSDSSAKFASWREVQIKT
RADAILALEKACAYFEVYEPSHPAPFIIRRLQQAIPLNFFEMLKNLAPSGSEQFEQTWVPREEEDSSSSS
DDY
 
Nucleotide Sequence: 1062 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1197226-1198287 Taylorella equigenitalis 14/56 draft genome
ATGATGAATTTTGATGAGTTATTTCCCTCATTCGATAATGATGATTGTGGGGCCAATCTTGAGTATGATT
CAGATTTTCTGAATCTAGTACAGGCTTCTGTCCCAAAACCTGAACAGCAGTTCGGGGATGCTGTTATCGA
AGCCCAGCCGCCTGATTGGGCCAAAGTTGAAAAAATGGCATTGGAATTATGTAAGCGTTCATGTGATGTT
CGCATACTACAGATATTGACTTATGCCTGGACATTTCAACGTGGTCTCGTTGGCTATGCTCAGGGTATTG
ATTTAGTTCATCAGGCATTAGAAAAGTGTTGGGATTCTATTAATCCTCCGCTTTTTGAAGAAGATGGTTA
TGAAGATCCTATGCCTCGCGTAAATGCGATTTCGGCATTGGGTGATTTGAGCACCTTAGGTAGAGGTATT
CGTAGTTCAAAACTTTTATCGGATAACTACGGTAATTTAACTGTACGTGAAGGTGAAGCCATCATCGATG
GAAGTAACGATGGGTTTCCAGGTGGAAAAAATCGATTGTCTGAGCTTTTATCTCAAGCTACTCAATCCGA
AAATGAAATCGCTTTGGCTATTCCCGTTGCTTTTAATGCTTTACAAAGCATAGAGGATTTAGTAGTTGAA
AAGTTGGGTCATGATTGGCGTCCAGATTTTCCAACTATTAAGTCTTTATTTGGTTCGTTTGTTCACTTAA
TTAACTCTAGACCTTCAACTAGTAGTTCGGAGGCGGTTGTTGAAAGCACTGAAATTTCAGAATCATCAAC
TCAATCAAGTGATACATCTTCTGATTCTTCAGCTAAGTTTGCTTCTTGGCGTGAGGTTCAGATTAAAACT
AGGGCGGATGCGATATTGGCATTGGAGAAGGCTTGTGCTTATTTCGAAGTTTATGAGCCTAGTCATCCAG
CACCTTTTATTATTCGCAGATTGCAGCAAGCGATTCCTCTTAATTTCTTTGAAATGCTTAAGAACCTGGC
CCCATCTGGTTCTGAGCAGTTCGAACAGACTTGGGTTCCTAGAGAAGAAGAGGATTCAAGTAGTTCTTCT
GATGATTATTAA