SecReT6
Protein ID: 479197095
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1106
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1198325..1198858 [+]
Producthypothetical protein
NoteTssB
UniProt IDI7IZJ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-60, Aligned region: 12..165
Protein Sequence: 177 a.a.     [Download]
>gi|479197095|ref|YP_007826464.1| conserved hypothetical protein [Taylorella equigenitalis 14/56]
MGSRSKSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMAVMSDLTGKSTVEQPEVSERKFSEIDVDN
FDDRMKAIAPRVDVSVPNTLTGQGRLYVDLTFNSMDDFSPANIARNVEPLAKLLEARTELSNLLTYMDGK
SGAEELINKVLENPALLKSLAAAPNKSSSDDAQQDQE
 
Nucleotide Sequence: 534 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1198325-1198858 Taylorella equigenitalis 14/56 draft genome
ATGGGCTCAAGAAGTAAAAGTGGTCAAAAGTTTATTGCACGTAACCGTGCACCACGTGTTCAAATTGAAT
ATGATGTAGAGATCTACGGTGCAGAGCGTAAAATTCAGCTCCCATTTGTTATGGCAGTTATGTCAGATTT
GACTGGTAAGTCTACTGTGGAACAACCTGAAGTAAGTGAACGTAAATTTAGCGAAATCGATGTAGATAAC
TTTGATGATCGCATGAAAGCAATTGCCCCTCGCGTGGATGTTTCTGTTCCAAATACTCTTACTGGTCAAG
GTAGACTTTACGTTGACCTTACTTTTAACAGTATGGATGATTTTAGCCCAGCAAACATTGCCCGTAACGT
TGAGCCTCTAGCAAAATTATTAGAAGCTAGGACTGAGCTTTCAAACTTATTAACTTATATGGATGGTAAA
TCTGGTGCTGAAGAATTGATTAACAAAGTTCTTGAAAATCCTGCTTTACTTAAATCCCTTGCTGCTGCTC
CAAACAAATCATCTTCAGATGATGCTCAACAAGATCAAGAATAG