SecReT6
Protein ID: 479197096
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1107
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1198867..1200360 [+]
Producthypothetical protein
NoteTssC
UniProt IDI7IJI1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.10E-197, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|479197096|ref|YP_007826465.1| conserved hypothetical protein [Taylorella equigenitalis 14/56]
MATEALKQSQEKGTIEVEGLSSLLKKEFKPKTEEAQSAVESAVKTLAEQALSSAVTISSDSYITIQNIIA
EIDRKLSQQINVILHNEEFQKLEGAWRGLHYLVNNTETDEMLKIRFMPISKKELGRTLKRHKGTAWDQSP
IFKRIYEEEYGQFGGEPIGCIVGDYHFDHSPPDVELLGEMAKISAAAHCPFISGADPSLMQMDSWQELSN
PRDLSKIFTNTEYAAWRSLRETDDSRYLGLTLPRFLARLPYGARTNPVDEFDFEEDTEGANHNNYTWANS
AYAMAANINRSFKEYGWCTSIRGVESGGAVEGLPTHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMP
LVHRKNSDFAAFIGAQSLQKPAEYDDPDATANARLSARLPYLFACCRFAHYLKCIVRDKVGSFTSRIEME
DWLNTWIMNYVDGDPANSSQETKARKPLAAAEVQVAEIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKL
PSLKKAG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1198867-1200360 Taylorella equigenitalis 14/56 draft genome
ATGGCTACTGAAGCTTTAAAACAAAGTCAAGAAAAAGGCACGATTGAAGTTGAGGGCTTATCTTCACTTC
TTAAAAAAGAATTTAAACCTAAAACAGAAGAAGCACAAAGTGCTGTTGAAAGTGCAGTTAAAACTCTAGC
TGAACAAGCACTTTCATCTGCTGTAACTATCTCCTCAGATTCATACATTACTATTCAAAATATTATTGCT
GAGATTGATCGTAAATTATCTCAACAAATTAACGTAATTCTTCATAACGAAGAGTTCCAAAAACTAGAAG
GTGCTTGGCGCGGTCTACATTACTTAGTTAATAACACTGAAACAGATGAGATGTTAAAAATCCGTTTCAT
GCCTATTTCTAAAAAAGAATTAGGTCGTACATTAAAACGTCACAAAGGTACAGCATGGGACCAAAGTCCT
ATATTCAAACGTATATACGAAGAAGAGTATGGTCAATTCGGTGGTGAACCTATCGGATGTATCGTTGGAG
ATTATCACTTCGATCACAGTCCTCCAGATGTAGAGCTTTTAGGTGAAATGGCTAAGATATCTGCTGCTGC
TCACTGCCCATTTATCTCTGGTGCTGACCCTTCACTTATGCAGATGGATTCATGGCAGGAACTTTCAAAT
CCACGTGATTTAAGCAAAATCTTCACAAATACTGAGTATGCAGCATGGAGAAGCCTACGTGAAACTGATG
ACTCACGTTATTTAGGTTTGACATTGCCTCGCTTCCTGGCTCGTCTACCATACGGTGCTCGTACTAATCC
AGTTGATGAGTTTGATTTCGAAGAAGATACAGAAGGTGCAAACCACAATAACTACACTTGGGCTAACTCT
GCATATGCGATGGCTGCAAATATCAACCGTTCATTTAAAGAGTATGGTTGGTGTACATCAATTCGTGGTG
TAGAGTCAGGTGGTGCGGTTGAAGGCTTACCTACTCACACATTCCCTACCGATGACGGTGGCGTGGATAT
GAAATGTCCAACTGAAATTGCTATTTCAGACCGTCGCGAAGCTGAACTAGCTAAAAATGGTTTCATGCCA
CTAGTTCACCGTAAAAATTCAGACTTTGCTGCGTTTATCGGAGCTCAGTCATTGCAAAAACCTGCAGAGT
ATGATGATCCTGATGCAACAGCAAATGCTCGTCTTTCTGCACGTTTACCTTATTTGTTTGCTTGCTGCCG
TTTCGCACACTACTTAAAATGCATCGTGCGTGATAAAGTGGGTTCATTTACTAGTCGTATTGAGATGGAA
GATTGGTTGAATACTTGGATTATGAACTATGTTGATGGAGATCCAGCTAACTCTTCTCAAGAAACTAAAG
CTCGTAAACCACTTGCTGCTGCTGAAGTACAAGTTGCGGAGATTGAAGATAATCCAGGCTATTATGCTGC
TAAATTCTTCTTGCGTCCGCATTATCAGTTAGAGGGTTTAACCGTTTCATTAAGGTTAGTCTCTAAACTG
CCATCCCTTAAAAAGGCTGGCTAA