SecReT6
Protein ID: 479197097
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1108
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1200428..1200913 [+]
Producthypothetical protein
NoteTssD
UniProt IDI7JKE5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-36, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|479197097|ref|YP_007826466.1| conserved hypothetical protein [Taylorella equigenitalis 14/56]
MAVDMFLKISSVEGESKDSKHAKWTDIESFAWGATQPGSMATGGGGGTGKASFNDLHVICRIDRAAPTVM
KHCATGKHLDKVEISVNKAGGEQVEYSKITLEDVLVTSVQYTGEKDGDAMMVSYSFQGAKVKQQYWEQSD
KGTKGAESVVGYDIKQNKATA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1200428-1200913 Taylorella equigenitalis 14/56 draft genome
ATGGCTGTTGATATGTTCTTAAAAATTTCAAGTGTTGAAGGTGAATCTAAAGACTCTAAACACGCTAAAT
GGACTGACATCGAATCATTCGCTTGGGGTGCTACTCAACCTGGTTCTATGGCTACTGGTGGTGGCGGCGG
TACTGGCAAAGCTAGTTTCAACGACCTTCACGTTATTTGCCGCATCGACCGTGCTGCACCTACAGTAATG
AAACATTGTGCTACTGGTAAACACTTAGACAAAGTTGAAATTTCTGTAAACAAAGCTGGTGGCGAACAAG
TTGAATACTCTAAAATCACTTTAGAAGACGTTCTTGTTACTTCAGTTCAATACACTGGTGAAAAAGATGG
CGACGCTATGATGGTTAGCTACTCTTTCCAAGGTGCTAAAGTTAAACAACAATACTGGGAGCAATCAGAT
AAAGGTACTAAAGGTGCTGAATCTGTTGTTGGTTACGACATCAAACAAAATAAAGCTACTGCTTAA