SecReT6
Protein ID: 479197099
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1110
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1201845..1202408 [+]
Productlysozyme-like protein
NoteTssE
UniProt IDI7JQ54
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.40E-17, Aligned region: 54..163
Protein Sequence: 187 a.a.     [Download]
>gi|479197099|ref|YP_007826468.1| lysozyme-like protein [Taylorella equigenitalis 14/56]
MITAHQKRKLDSISRKSDQDYKDKLQPVLLDKLTDEHPERRKELREAATVINFEQLKKSVLRDLGWLLNT
VNLESIESLDGYNHVKSSTINFGVFPVAGQKMSEINHIEIQNQVRNAIINFEPRILPNDLEVICELEESD
LEHYNVLSLIIKGRLWCNPHPMEFFLRTSVDLESGHMEIKDEGRGSL
 
Nucleotide Sequence: 564 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1201845-1202408 Taylorella equigenitalis 14/56 draft genome
ATGATTACAGCTCATCAAAAAAGAAAACTCGATAGCATCTCTAGAAAAAGCGATCAGGATTACAAAGATA
AACTTCAGCCTGTATTGCTTGATAAACTTACTGACGAGCATCCAGAAAGACGAAAAGAACTCAGGGAAGC
TGCTACAGTTATTAATTTTGAACAACTAAAAAAGTCCGTACTTAGAGATTTAGGTTGGTTGCTAAACACT
GTTAATTTAGAATCTATTGAGTCTTTGGACGGATATAATCACGTTAAAAGTTCAACTATAAATTTTGGCG
TTTTCCCTGTAGCTGGTCAGAAAATGTCAGAAATCAATCATATTGAAATTCAGAATCAAGTAAGAAACGC
AATAATTAATTTTGAGCCTAGAATTTTACCTAATGATCTTGAAGTTATCTGTGAATTAGAAGAGTCAGAT
TTAGAACACTACAACGTGTTGTCTCTTATAATCAAGGGCAGATTATGGTGTAACCCTCATCCTATGGAGT
TTTTTCTACGTACCTCAGTTGACTTAGAGTCAGGTCACATGGAGATTAAGGACGAAGGTAGAGGATCCTT
ATAA