SecReT6
Protein ID: 479197100
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1111
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1202408..1204303 [+]
Producthypothetical protein
NoteTssF
UniProt IDI7IZJ8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.40E-189, Aligned region: 6..630
Protein Sequence: 631 a.a.     [Download]
>gi|479197100|ref|YP_007826469.1| conserved hypothetical protein [Taylorella equigenitalis 14/56]
MENDFIEYYNRELAYIREMGREFAEQYPKVASRLGMEGIQVPDPYVERLMEGFSFLTARIHKKMDAEFPQ
FTQNLLEVLYPHYVSPTPAIGIIDFDVNSKKGDLVKGYTLPKGTVFRARTGGKECRFSTGSEVTFHPLVI
EEAEVTSSMSDLPPKLLKSFRGNKQIRSALRVQIKVVGGSNIADLKNFNKLNFFLNGEEVYTHKLLEMLM
AHTIGIVVHDHERPVRWTKFLDVKNLKHEGFETNQSLLPTDSRVFQGYRLLHEYFAFPYKYLYVSLSGIQ
QAITLPEELQKQKIKSFEVTFLFDKIAHDLEGVITAENLRLHSVPVINLFPMLANRINILPNAHEYHVVV
DKAKPLDYEIYSLTKVTVNAPGAKETKEFRPFFDVYGAEGQTIHQFYSVRREARKASLSANQISRRTGYR
GSEIFISIVDVDNPPYDNHTVFGLNIETMSTNRDLPYIFNSGGDVDFRFNVSVPVDRISFIKKPTRTRAP
IGREAYSWRLINHLNLNYLNLLDSNEESGAEAVRELLHIYSDLGDPMLARQIQGIRSIKLEPIYRRMPVR
GSIVFGRGVSIKVLVDENEFAGISPYLFGSILDQFFSRHVSINMLTELELSSLQSGLIATWKPRLGGRPT
V
 
Nucleotide Sequence: 1896 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1202408-1204303 Taylorella equigenitalis 14/56 draft genome
ATGGAAAACGATTTTATTGAGTACTACAATCGCGAGTTAGCTTATATTCGCGAAATGGGACGAGAATTTG
CTGAGCAATATCCAAAAGTTGCTAGTCGTTTGGGTATGGAGGGCATACAAGTTCCCGACCCTTATGTTGA
GCGTCTTATGGAGGGCTTTAGCTTTTTAACAGCCCGTATCCATAAAAAAATGGATGCCGAGTTTCCTCAA
TTTACACAGAATTTGCTAGAAGTTCTGTACCCACACTACGTATCACCTACACCTGCAATCGGAATAATCG
ACTTCGATGTTAATTCTAAAAAGGGGGACCTAGTAAAAGGGTATACATTGCCAAAAGGTACAGTTTTCAG
AGCTAGGACTGGTGGCAAAGAGTGCCGATTTTCTACTGGAAGTGAGGTTACATTTCACCCATTAGTAATT
GAAGAAGCTGAAGTTACATCCTCTATGAGCGACCTACCTCCTAAACTTTTAAAAAGTTTTAGAGGAAACA
AGCAAATTAGAAGTGCACTTAGAGTTCAAATCAAAGTCGTAGGCGGAAGTAATATTGCAGATTTGAAAAA
CTTCAATAAGTTGAATTTTTTTCTTAATGGCGAAGAGGTTTATACTCACAAACTCCTTGAGATGCTTATG
GCTCACACTATCGGCATAGTTGTGCACGATCATGAGAGACCAGTTAGATGGACAAAATTTCTTGATGTAA
AAAATCTCAAGCATGAGGGGTTTGAGACGAATCAATCATTATTGCCAACTGATAGCAGGGTTTTTCAGGG
ATACAGACTACTTCATGAATATTTTGCATTTCCGTACAAGTATTTATATGTAAGTTTAAGTGGGATACAG
CAAGCAATAACATTGCCAGAGGAACTGCAAAAGCAAAAGATCAAGTCTTTTGAGGTCACTTTCCTGTTCG
ATAAAATTGCACATGACCTTGAGGGTGTAATTACAGCTGAAAACTTGCGTCTACATAGTGTTCCAGTTAT
TAATTTGTTTCCTATGTTGGCTAATAGGATTAATATCCTCCCGAATGCTCATGAGTATCATGTAGTCGTG
GATAAGGCTAAACCTCTTGATTATGAAATCTACTCGCTGACTAAGGTTACGGTAAATGCTCCTGGAGCTA
AAGAGACTAAGGAATTTCGACCATTTTTTGATGTTTATGGAGCTGAAGGTCAAACTATCCATCAGTTTTA
TTCTGTTAGGCGTGAAGCACGTAAAGCATCTCTTAGTGCTAATCAAATTAGCAGAAGAACTGGTTATCGA
GGAAGTGAAATCTTTATTTCAATCGTAGATGTCGATAATCCTCCTTACGACAATCATACAGTATTTGGAC
TTAATATTGAGACGATGTCCACGAATAGGGACTTGCCATATATTTTTAACAGTGGTGGAGATGTTGATTT
TAGATTTAATGTTTCTGTTCCGGTAGATAGGATAAGTTTTATAAAAAAACCAACTCGTACAAGGGCTCCA
ATAGGCAGAGAAGCTTATTCGTGGCGGTTGATCAATCACTTAAATTTAAATTACCTTAATTTGTTAGACT
CTAATGAGGAATCTGGTGCGGAGGCGGTTAGAGAATTATTGCATATTTACTCTGACCTTGGAGATCCGAT
GTTAGCTAGACAAATTCAGGGGATTAGAAGCATTAAACTTGAGCCTATTTATAGACGTATGCCTGTCAGA
GGTTCTATAGTATTTGGTCGTGGAGTTAGTATTAAAGTATTGGTCGATGAAAATGAATTTGCAGGTATTA
GTCCTTATTTATTTGGATCAATTTTAGACCAATTCTTTTCTCGTCACGTTTCTATTAATATGCTCACAGA
GCTTGAATTGTCATCTTTGCAGTCAGGATTGATAGCTACTTGGAAACCTAGACTTGGTGGTAGGCCCACA
GTGTAA