SecReT6
Protein ID: 479197104
SecReT6 ID750
T6SS typei3
Gene symbol-
Locus tagKUK_1115
StrainTaylorella equigenitalis 14/56
Repliconchromosome [GenBank: NC_021036] [Browse all T6SS(s) in this replicon]
Location [Strand]1208928..1210472 [+]
ProductRhs family protein
NoteTssI
UniProt IDI7JQ57
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-71, Aligned region: 24..323
Phage_base_V [PF04717], Evalue: 3.80E-23, Aligned region: 364..455
Protein Sequence: 514 a.a.     [Download]
>gi|479197104|ref|YP_007826473.1| Rhs family protein [Taylorella equigenitalis 14/56]
MSNRHVNVDAAVSGLKIYSFKGKEHLSKLFEYEVELVSENGHLDVRDMLGTSLTIEIEMSLLQTRYLNGR
VIGFELVGPDPDGSEYYIYKAKVVPNLWFLTKAKDYKIFQEKKAEDIIKEVLDKYSIDYEFKLSGSYRNW
EYLVQYEESPFDFISRLMEHEGMYYWFKHEKGSNKLVISDSAEAHEFLIGYQNLNYLKPTFAFMDTNEVI
SDWSHKAQVSPSKYSVIDFDFRKPSTSLDANNENQLKNDDSVEVYEWQGGYQELSDGDNYAQLRIQELQV
SQEIIEAKSNIRGVVPGYKFVLLNHPRLVENNEYLVIGAEYDVVVHAYNTNDERKDKFAINFKCIPMAVQ
FRAPRTTKIPKTTGPQTATVVGPQGEEIYTDKYGRIKVQFHWDRDGKKDENSSCWIRVSNIWANSGYGGL
FIPRIGSEVIVDFIGGNPDRPIVVGCVYNEDYMPLMNLPDEKHTSGIRTRTIQGGSDNQNFLLFRDKQGD
ELIDVQAERDMNIFVKNDFFLTVG
 
Nucleotide Sequence: 1545 bp     [Download]
>gi|479196022|ref|NC_021036.1|:1208928-1210472 Taylorella equigenitalis 14/56 draft genome
ATGTCAAATCGCCACGTAAATGTAGATGCAGCTGTTTCAGGGTTAAAAATATACAGTTTTAAGGGCAAAG
AGCATCTTTCTAAACTATTTGAATATGAAGTTGAGCTTGTCTCTGAAAATGGTCATCTTGATGTTAGAGA
TATGCTAGGTACATCGCTTACCATTGAAATAGAGATGTCTTTGTTGCAAACTCGATATTTAAACGGTAGG
GTTATAGGATTTGAATTGGTTGGTCCAGATCCCGATGGGTCAGAATATTATATATATAAAGCTAAAGTTG
TGCCGAATTTATGGTTTCTTACTAAAGCTAAAGATTACAAAATTTTCCAAGAAAAAAAGGCTGAAGATAT
TATCAAGGAAGTTTTGGACAAATATAGCATTGATTACGAATTTAAACTTTCAGGAAGCTACCGTAATTGG
GAATACTTAGTTCAGTATGAAGAATCTCCTTTTGATTTCATATCTCGTCTAATGGAACATGAGGGTATGT
ACTATTGGTTTAAACATGAAAAAGGTTCTAATAAATTAGTCATATCTGATAGTGCTGAGGCACATGAATT
TTTAATTGGGTATCAAAACTTAAATTACTTGAAACCTACTTTTGCCTTCATGGATACAAATGAAGTCATT
TCTGACTGGAGTCATAAAGCTCAAGTATCACCGTCTAAATATTCTGTTATTGACTTTGATTTTCGCAAGC
CAAGTACGTCTTTGGATGCCAATAATGAAAATCAACTCAAAAACGACGATTCTGTAGAAGTGTATGAATG
GCAGGGTGGGTATCAAGAGCTTTCAGACGGTGATAATTATGCTCAATTACGCATTCAGGAATTGCAAGTT
AGTCAAGAGATTATAGAGGCTAAGTCTAATATTCGTGGTGTTGTACCAGGCTATAAGTTTGTACTTTTAA
ATCACCCTAGGTTAGTAGAAAATAACGAATACTTAGTTATTGGTGCTGAATACGACGTTGTTGTTCATGC
CTATAATACTAATGATGAAAGAAAAGACAAATTTGCCATTAATTTTAAATGTATTCCAATGGCAGTTCAA
TTTAGGGCACCTAGAACTACTAAGATTCCTAAAACTACAGGTCCTCAAACAGCTACAGTTGTGGGTCCTC
AAGGTGAGGAAATATACACGGATAAATATGGTCGAATTAAAGTTCAATTTCACTGGGATAGAGATGGCAA
AAAAGATGAAAATTCATCATGCTGGATTAGGGTTTCAAATATTTGGGCTAATTCTGGATACGGTGGCCTA
TTTATACCAAGAATTGGTTCTGAAGTTATTGTAGATTTTATTGGTGGTAATCCTGATCGCCCAATAGTAG
TAGGGTGTGTGTACAACGAAGATTATATGCCTTTGATGAATTTACCTGATGAAAAGCATACTTCTGGAAT
TAGAACACGCACAATACAGGGCGGAAGTGATAATCAGAATTTCCTTTTGTTTAGAGATAAACAAGGAGAT
GAGTTGATTGATGTTCAGGCTGAACGTGATATGAATATATTTGTTAAAAATGACTTTTTCTTAACGGTTG
GATAA