SecReT6
Protein ID: 479271622
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_08900
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]935277..935768 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDD6DQQ4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-52, Aligned region: 6..158
Protein Sequence: 163 a.a.     [Download]
>gi|479271622|ref|YP_007844901.1| type VI secretion protein, VC_A0107 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MADSFQNEVPKARINLKLALHTGGAQKNIELPLKLLTVGDFSNGKENRPLSERDKINVNKNNFNSVLSEF
NPEVNLTVPNTMAGDGSEESIKLNFSDIKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNATFRKEL
EKILKDPALSQELRDEMSALAPK
 
Nucleotide Sequence: 492 bp     [Download]
>gi|479270911|ref|NC_021046.1|:935277-935768 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGCCGATTCATTCCAGAATGAGGTGCCCAAGGCACGTATAAATTTAAAGCTGGCTCTGCATACAGGTG
GCGCGCAGAAGAATATAGAACTGCCGCTTAAACTCCTCACCGTCGGTGATTTCAGTAATGGAAAAGAGAA
TCGCCCATTATCGGAAAGGGACAAAATTAACGTCAATAAAAATAACTTCAACAGCGTACTTTCGGAATTT
AACCCGGAAGTGAATCTGACGGTTCCTAACACAATGGCCGGGGATGGTTCGGAAGAAAGCATAAAACTGA
ATTTCTCCGATATTAAGGATTTCGAACCTGAACAGGTTGCCCGCCAGATCCCCCAGCTCCGCGCCATGCT
GGCCATGCGTAATTTATTACGCGATCTCAAATCCAATCTTCTTGATAACGCCACTTTCAGAAAAGAACTC
GAGAAAATTCTTAAAGACCCGGCGCTGTCTCAGGAATTACGCGACGAAATGAGTGCACTGGCCCCGAAAT
AA