SecReT6
Protein ID: 479271623
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_08910
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]935803..937344 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDD6DQQ5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.80E-173, Aligned region: 87..509
Protein Sequence: 513 a.a.     [Download]
>gi|479271623|ref|YP_007844902.1| type VI secretion protein, EvpB/VC_A0108 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MLMSVNTETASAQGQTTVLEKEGVYASLFEKINLTPASSLGDINAFLDDAALSDAPAGERLTAAMQVFMD
CIRKSGQPVEKLDKTLIDHHIAELDFQISRQLDAVMHHQEFQKVESLWRGLKQLVDSTDYRQNVKTEILD
VSKEDLRQDFEDAPELIQSGLYWHTYTAEYDTPGGEPIGSVISSYEFDASPQDVALLRNISKVSAAAHMP
FIGSVGPKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDARYIGLVMPRVLGRLPYGPDTVPVRS
FNYVEQVKGPDHEKYLWTSASFSFASNMVKSFINNGWCVQIRGPQAGGAVKDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWVRSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLFAV
PHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|479270911|ref|NC_021046.1|:935803-937344 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGCTGATGTCTGTAAATACTGAAACCGCCTCCGCGCAGGGGCAGACCACCGTACTGGAAAAAGAGGGCG
TTTACGCCTCCCTGTTTGAAAAAATCAACCTGACCCCGGCCTCCAGCCTGGGGGATATCAATGCGTTTCT
GGATGACGCCGCGCTTTCTGACGCTCCGGCGGGTGAACGCCTGACGGCGGCGATGCAGGTGTTTATGGAC
TGCATCCGCAAATCCGGTCAGCCTGTGGAGAAGCTCGACAAAACGCTGATTGACCACCATATCGCTGAGC
TGGATTTCCAGATCAGCCGTCAGCTGGATGCCGTAATGCATCACCAGGAGTTCCAGAAGGTGGAGTCCCT
GTGGCGCGGCCTGAAGCAGCTGGTGGACAGCACCGACTACCGCCAGAACGTGAAAACCGAAATTCTGGAT
GTGTCGAAAGAAGATCTGCGTCAGGACTTTGAAGACGCGCCGGAACTTATCCAGAGCGGCCTCTACTGGC
ACACCTATACCGCCGAATACGACACCCCGGGCGGCGAGCCGATTGGCTCCGTGATTTCATCCTATGAATT
TGACGCCAGCCCGCAGGATGTGGCGCTGCTACGCAACATCTCTAAAGTGTCAGCTGCCGCACATATGCCG
TTTATTGGCTCTGTCGGTCCGAAATTCTTCCTGAAAGACTCCATGGAAGAGGTCGCTGCAATTAAGGATA
TCGGCAACTACTTCGACCGCGCGGAATACATCAAGTGGAAATCGTTCCGCGACACCGACGACGCCCGCTA
TATCGGCCTCGTGATGCCGCGCGTGCTGGGGCGTCTGCCGTATGGCCCGGACACCGTACCTGTACGCAGC
TTTAACTACGTTGAGCAGGTGAAAGGCCCGGATCACGAGAAATACCTGTGGACTAGTGCGTCGTTCTCCT
TCGCGTCAAACATGGTAAAGAGCTTCATCAATAACGGCTGGTGCGTGCAGATCCGTGGCCCGCAGGCGGG
CGGGGCGGTGAAAGACCTGCCTATTCATCTGTACGATCTGGGTACCGGCAACCAGGTGAAAATCCCGTCT
GAGGTGATGATCCCGGAGACCCGCGAGTTTGAGTTCGCCAACCTCGGCTTTATCCCGCTCTCGTATTACA
AAAACCGCGACTATGCCTGCTTCTTCTCGGCGAACTCCGCGCAGAAACCGGCGCTGTATGACACCGCAGA
TGCCACGGCCAACAGCCGCATCAACGCCCGTCTGCCGTATATCTTCCTGCTGTCGCGTATTGCGCACTAC
CTGAAGCTCATCCAGCGCGAGAACATTGGCACCACCAAGGACCGCCGTCTGCTGGAGCTGGAGCTGAATA
CCTGGGTGCGTAGTCTGGTGACGGAAATGACCGATCCGGGCGATGAGTTGCAGGCTTCTCATCCGCTGCG
TGACGCGAAGGTGGTGGTGGAAGATATCGAAGACAACCCGGGTTTCTTCCGCGTGAAGCTTTTTGCGGTG
CCGCACTTCCAGGTGGAAGGCATGGATGTGAACCTGTCTCTGGTGAGCCAGATGCCGAAAGCGAAAGCGT
AA