SecReT6
Protein ID: 479271624
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_08920
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]937360..938700 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDD6DQQ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-136, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|479271624|ref|YP_007844903.1| type VI secretion protein, VC_A0114 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MKTEQPLWGRGQMVSPQHFQQQAAYAAWSAECIARLGLSHPWGVINATFEPDVLKLGRLQARHLHLRFPD
GTLIDTDNADDLPPVLALESETQDVVVVLALPLLRANGGNCLKPDEVAARPVRYRQRWRDVRNLFGDDTR
QIAVMRPELTLRFAHQNNSDYLTCPVARLQQDSQGNWALDETYLPPLLALLGSRWLMTQLEQLLTQLRAR
LGRLMDMRRESNERMADFAVADVSLFWLLNALNSAEPVLGQFQRHPQSPPERLYPELARLAGSLLTFSLE
HQVSAIPAWQHEQLNNVFPPLFDLLGDLLEASLPSRVVAIELEHDDRLHFWQARLHDPRLREGADYYLSV
RSPMPVAQLQEQFPRQCKVGSPDHVRSIVNSSRVGVPLMPLRHVPAAIPLRLENQYFSLDVSHPLAIEMF
QSGTCMFYVPGMLAEPELELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|479270911|ref|NC_021046.1|:937360-938700 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGAAAACGGAACAACCGTTATGGGGCAGGGGCCAGATGGTCTCTCCCCAGCACTTCCAGCAACAGGCCG
CCTATGCGGCCTGGTCTGCGGAATGTATCGCCCGACTGGGTCTCTCCCATCCCTGGGGGGTGATTAATGC
CACTTTCGAACCGGATGTACTGAAGTTGGGCCGTCTACAGGCCCGTCATCTGCACCTCCGGTTCCCTGAC
GGGACATTAATCGATACGGATAATGCTGACGACCTGCCACCGGTGCTGGCGCTTGAGAGTGAAACACAGG
ACGTGGTGGTGGTTCTGGCTCTTCCGCTGCTGCGCGCGAATGGTGGCAACTGCCTTAAGCCCGATGAGGT
GGCCGCGCGTCCTGTTCGCTATCGCCAGCGCTGGCGGGATGTCCGCAACCTTTTTGGCGATGATACCCGC
CAGATTGCGGTGATGCGGCCAGAGCTGACGTTGCGATTTGCCCATCAGAACAACAGCGATTACCTGACCT
GTCCGGTTGCCCGCCTGCAACAAGATTCGCAGGGGAACTGGGCACTTGATGAGACATACCTTCCGCCGCT
GTTGGCGTTACTGGGCAGTCGCTGGCTGATGACCCAGCTGGAGCAACTGTTGACGCAACTGCGCGCCCGT
CTGGGCCGCCTGATGGACATGCGCCGGGAAAGTAATGAGCGCATGGCGGATTTTGCCGTAGCCGATGTTT
CATTGTTCTGGCTGCTCAATGCCCTGAACAGTGCTGAGCCCGTGCTGGGTCAGTTTCAGCGCCACCCGCA
AAGCCCGCCTGAGCGTCTCTATCCGGAGCTGGCAAGGCTTGCAGGCAGCCTGTTGACATTCTCGCTGGAG
CATCAGGTCAGTGCGATCCCGGCATGGCAGCATGAGCAGCTGAATAACGTCTTCCCGCCGCTGTTTGATT
TACTTGGCGATCTTCTGGAAGCCAGCCTGCCGTCGCGGGTGGTGGCAATTGAGCTTGAGCATGATGACCG
GCTTCACTTCTGGCAGGCCCGTCTGCATGATCCACGTCTGCGCGAAGGGGCTGATTATTACCTCTCCGTG
CGTTCACCGATGCCGGTGGCACAATTGCAGGAGCAGTTCCCGCGCCAGTGCAAGGTCGGCAGTCCCGATC
ATGTCAGGAGTATCGTCAATTCATCGCGGGTGGGCGTCCCTCTGATGCCGCTGCGCCATGTGCCGGCAGC
CATTCCACTACGTCTGGAAAATCAGTATTTCAGCCTTGATGTCTCTCATCCTCTGGCCATCGAAATGTTC
CAGAGCGGCACCTGTATGTTTTACGTTCCGGGAATGCTCGCCGAGCCTGAACTTGAACTCTTTGCGGTAC
TGAGAACATGA