SecReT6
Protein ID: 479271625
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_08930
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]938697..939386 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDD6DQQ7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.30E-39, Aligned region: 14..216
Protein Sequence: 229 a.a.     [Download]
>gi|479271625|ref|YP_007844904.1| type IV / VI secretion system protein, DotU family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MNDRKRATAAFIDIDALLQDTWLQVISLRHGPTFQDGEGRTLWERCIDDVGRVQRELKASELDEASCQHI
LTAQCALLDEAVKGRGVEDDACIQWYDIPLQGYFLGTMDAGDTLCDRMRDVLREPAPDHAVVTCFQRVMM
LGFLGNFRSLNDPERQKLMNALNEYVAPFSYSQPHPVLAESHAGRGIGGWLASWPMRIGLSVVVVTALWW
GLDCWLDQTLLTLLPGAVK
 
Nucleotide Sequence: 690 bp     [Download]
>gi|479270911|ref|NC_021046.1|:938697-939386 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGAATGATCGTAAACGCGCTACTGCCGCGTTCATTGATATTGATGCCCTGTTACAGGACACCTGGCTAC
AGGTGATCAGTCTGCGTCACGGCCCGACATTCCAGGACGGGGAAGGTCGTACGCTTTGGGAGCGCTGCAT
TGATGATGTCGGGCGTGTGCAGCGAGAACTGAAAGCGAGCGAACTCGATGAAGCCAGCTGCCAGCATATT
CTTACGGCACAGTGTGCGCTGCTTGATGAGGCGGTCAAAGGTCGCGGTGTAGAGGATGACGCCTGTATAC
AGTGGTATGACATTCCCTTACAGGGATACTTTCTTGGCACCATGGACGCCGGTGACACGTTATGCGATCG
GATGCGTGATGTGCTGCGTGAACCGGCTCCTGACCACGCCGTTGTGACCTGCTTCCAGCGAGTCATGATG
CTCGGATTCCTCGGCAACTTCCGCTCCCTGAACGATCCTGAGCGGCAGAAACTCATGAATGCACTGAATG
AATATGTTGCGCCGTTCAGCTATTCACAACCCCATCCCGTTCTGGCGGAAAGCCATGCCGGACGGGGGAT
AGGGGGTTGGCTGGCATCATGGCCTATGCGCATTGGCCTGAGTGTGGTGGTGGTCACCGCATTATGGTGG
GGACTGGATTGCTGGCTGGATCAGACACTGCTTACCCTGCTGCCGGGAGCCGTGAAATGA