SecReT6
Protein ID: 479271626
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_08940
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]939383..941089 [+]
ProductOuter membrane protein and related peptidoglycan-associated (lipo)proteins
NoteTagL
UniProt IDD6DQQ8, D6DQQ8
KEGG IDeclo:ENC_08940
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 2.10E-16, Aligned region: 438..534
Protein Sequence: 568 a.a.     [Download]
>gi|479271626|ref|YP_007844905.1| Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Enterobacter cloacae subsp. cloacae NCTC 9394]
MSPAQQRGLALWAALLSAVVCLWFLPASRLVSILVLLAVLGLIIAFWAVACRRVQHDFTLCLEDLPEANY
CQPVVLVCGDLPLAWPHQSPVLTVTQGCWIRVEDHLELEQAARQVLWLRPDWGRQLSVMVSVCPQQHPDS
ERLTSRLLALRWQISRLRKATGHSVPLVLNGQVGSAMMNDMLWQTAILGEGVKVWSGTSAPGLVAEWVNT
GGTPAMQQQVLMNSLMSWFQQHVQAVLMDENPDIPVIEPVAVLWGLGPILTGSMVTSVWTAWLSRHTAMQ
QVSGWQPAGTDSTVISLFPNFVLPLLPEGRGLTPHGRTWRGALGILTLATIAALLSSGWNNRQLLQRVSF
DIARYERIPMNDSGPKADAVAVLREDAALLDDHARNGVPARLSLGLYQGGRLRMPVLNAIRSYVPPPPPP
EPELKPAPKIVRLDSMSLFDTGKWALKPASTKLLVNSLVGIKAKPGWLIVVAGHTDSTGDDQSNQVLSLK
RAESVRDWMRDTGDVPESCFAVQGYGESRPVATNDTAEGRALNRRVEISLVPQANACQAPGTTHASSQDD
GADNNVTE
 
Nucleotide Sequence: 1707 bp     [Download]
>gi|479270911|ref|NC_021046.1|:939383-941089 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGAGCCCTGCACAACAGCGCGGGCTTGCGCTCTGGGCTGCCCTGCTGAGTGCAGTGGTCTGCCTGTGGT
TTCTGCCAGCATCCCGTCTGGTTTCCATTCTCGTCCTGCTGGCGGTACTGGGACTCATCATAGCGTTCTG
GGCTGTCGCCTGCCGTCGCGTGCAGCACGATTTCACCCTGTGTCTGGAGGACCTGCCTGAAGCCAATTAT
TGTCAGCCCGTGGTACTGGTCTGTGGCGATCTGCCGCTTGCCTGGCCGCATCAGTCACCTGTGCTTACTG
TCACGCAGGGCTGCTGGATCCGTGTGGAGGATCATCTGGAACTGGAGCAGGCCGCCCGTCAGGTACTGTG
GTTGCGCCCCGACTGGGGACGTCAGCTGTCAGTGATGGTCAGTGTTTGTCCGCAGCAGCACCCTGACAGT
GAGCGCCTTACCAGTCGTTTGCTTGCCCTGCGCTGGCAGATTAGCCGGTTGCGTAAAGCAACCGGCCATT
CTGTGCCACTGGTTCTGAATGGACAGGTCGGCAGTGCGATGATGAATGACATGCTCTGGCAGACGGCGAT
CCTGGGGGAAGGGGTAAAGGTCTGGAGTGGGACTTCAGCGCCTGGCTTAGTTGCTGAATGGGTTAATACT
GGCGGAACGCCTGCGATGCAGCAACAGGTGCTGATGAACAGCCTGATGAGCTGGTTCCAACAGCACGTCC
AGGCTGTCCTTATGGATGAAAACCCCGATATTCCTGTCATTGAACCTGTTGCGGTTCTGTGGGGATTGGG
TCCGATCCTGACCGGAAGCATGGTCACCTCTGTCTGGACAGCGTGGTTGTCCCGCCATACTGCGATGCAG
CAGGTGTCTGGCTGGCAGCCGGCGGGAACGGACAGTACGGTTATTTCCCTGTTCCCGAATTTTGTCCTCC
CGTTACTGCCAGAAGGACGAGGCCTGACACCGCATGGTCGAACCTGGCGCGGTGCGCTCGGAATCTTAAC
GCTGGCGACCATTGCTGCGCTACTCAGCAGTGGCTGGAATAATCGCCAGCTGTTGCAACGCGTGAGCTTC
GATATTGCACGCTATGAACGTATACCGATGAATGACTCCGGGCCGAAAGCTGACGCCGTTGCCGTGCTGC
GCGAGGATGCGGCATTGCTGGACGACCATGCACGTAACGGTGTACCGGCCCGGCTGAGTCTGGGTCTGTA
TCAGGGCGGACGTCTGCGTATGCCAGTGCTGAATGCGATTCGCTCTTATGTGCCTCCGCCTCCGCCGCCT
GAACCGGAACTCAAACCGGCACCGAAAATTGTCCGCCTCGACAGCATGTCGCTGTTCGATACCGGAAAGT
GGGCGCTTAAACCCGCCTCAACAAAGCTGCTGGTGAACTCGCTTGTGGGGATCAAGGCGAAGCCCGGCTG
GCTGATTGTGGTCGCGGGCCATACCGACAGCACCGGGGATGACCAGTCCAACCAGGTGCTGTCGCTTAAG
CGTGCGGAGTCGGTGCGCGACTGGATGCGGGATACCGGCGATGTGCCGGAGAGCTGTTTTGCGGTGCAGG
GCTATGGTGAAAGCCGTCCTGTCGCCACCAACGACACGGCGGAAGGCCGGGCGCTGAACCGCCGTGTCGA
AATCAGTCTGGTACCGCAGGCGAATGCCTGTCAGGCGCCGGGCACGACCCATGCGTCATCTCAGGATGAT
GGCGCTGATAACAATGTAACGGAGTAA