SecReT6
Protein ID: 479271628
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_08960
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]941760..944405 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDD6DQR0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.30E-41, Aligned region: 233..254
AAA_2 [PF07724], Evalue: 4.30E-41, Aligned region: 607..772
AAA [PF00004], Evalue: 8.20E-21, Aligned region: 235..347
AAA [PF00004], Evalue: 8.20E-21, Aligned region: 612..736
AAA [PF00004], Evalue: 8.20E-21, Aligned region: 760..777
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 140..157
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 212..255
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 280..313
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 581..648
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 675..706
AAA_16 [PF13191], Evalue: 1.90E-15, Aligned region: 750..802
AAA_5 [PF07728], Evalue: 1.20E-14, Aligned region: 235..255
AAA_5 [PF07728], Evalue: 1.20E-14, Aligned region: 323..365
AAA_5 [PF07728], Evalue: 1.20E-14, Aligned region: 611..730
ClpB_D2-small [PF10431], Evalue: 8.10E-14, Aligned region: 778..854
AAA_22 [PF13401], Evalue: 1.30E-09, Aligned region: 234..320
AAA_22 [PF13401], Evalue: 1.30E-09, Aligned region: 608..653
AAA_19 [PF13245], Evalue: 5.60E-08, Aligned region: 232..255
AAA_19 [PF13245], Evalue: 5.60E-08, Aligned region: 607..634
AAA_25 [PF13481], Evalue: 9.00E-08, Aligned region: 235..298
AAA_25 [PF13481], Evalue: 9.00E-08, Aligned region: 289..323
AAA_25 [PF13481], Evalue: 9.00E-08, Aligned region: 607..640
Zeta_toxin [PF06414], Evalue: 1.60E-06, Aligned region: 229..258
Zeta_toxin [PF06414], Evalue: 1.60E-06, Aligned region: 603..651
Arch_ATPase [PF01637], Evalue: 2.10E-06, Aligned region: 213..251
Arch_ATPase [PF01637], Evalue: 2.10E-06, Aligned region: 287..385
Arch_ATPase [PF01637], Evalue: 2.10E-06, Aligned region: 604..651
IstB_IS21 [PF01695], Evalue: 3.00E-06, Aligned region: 229..255
IstB_IS21 [PF01695], Evalue: 3.00E-06, Aligned region: 611..631
AAA_17 [PF13207], Evalue: 3.70E-06, Aligned region: 235..300
AAA_17 [PF13207], Evalue: 3.70E-06, Aligned region: 610..647
Sigma54_activat [PF00158], Evalue: 1.40E-05, Aligned region: 218..250
Sigma54_activat [PF00158], Evalue: 1.40E-05, Aligned region: 611..728
AAA_14 [PF13173], Evalue: 5.20E-05, Aligned region: 235..325
AAA_14 [PF13173], Evalue: 5.20E-05, Aligned region: 609..693
NACHT [PF05729], Evalue: 6.00E-05, Aligned region: 235..262
NACHT [PF05729], Evalue: 6.00E-05, Aligned region: 611..635
NACHT [PF05729], Evalue: 6.00E-05, Aligned region: 691..763
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 235..257
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 612..641
Clp_N [PF02861], Evalue: 0.00055, Aligned region: 22..56
Clp_N [PF02861], Evalue: 0.00055, Aligned region: 105..122
AAA_33 [PF13671], Evalue: 0.0008, Aligned region: 235..252
AAA_33 [PF13671], Evalue: 0.0008, Aligned region: 610..633
T2SE [PF00437], Evalue: 0.00095, Aligned region: 158..254
T2SE [PF00437], Evalue: 0.00095, Aligned region: 608..689
RNA_helicase [PF00910], Evalue: 0.0011, Aligned region: 236..256
RNA_helicase [PF00910], Evalue: 0.0011, Aligned region: 612..633
RNA_helicase [PF00910], Evalue: 0.0011, Aligned region: 709..730
ResIII [PF04851], Evalue: 0.0017, Aligned region: 219..257
ResIII [PF04851], Evalue: 0.0017, Aligned region: 306..317
ResIII [PF04851], Evalue: 0.0017, Aligned region: 583..634
ABC_tran [PF00005], Evalue: 0.0026, Aligned region: 52..152
ABC_tran [PF00005], Evalue: 0.0026, Aligned region: 235..256
ABC_tran [PF00005], Evalue: 0.0026, Aligned region: 611..632
AAA_29 [PF13555], Evalue: 0.0044, Aligned region: 229..251
AAA_29 [PF13555], Evalue: 0.0044, Aligned region: 607..622
DUF258 [PF03193], Evalue: 0.0051, Aligned region: 221..252
DUF258 [PF03193], Evalue: 0.0051, Aligned region: 610..632
TIP49 [PF06068], Evalue: 0.0067, Aligned region: 235..256
TIP49 [PF06068], Evalue: 0.0067, Aligned region: 287..314
TIP49 [PF06068], Evalue: 0.0067, Aligned region: 579..642
AAA_28 [PF13521], Evalue: 0.0084, Aligned region: 235..254
AAA_28 [PF13521], Evalue: 0.0084, Aligned region: 611..631
DUF815 [PF05673], Evalue: 0.009, Aligned region: 225..310
DUF815 [PF05673], Evalue: 0.009, Aligned region: 611..647
Protein Sequence: 881 a.a.     [Download]
>gi|479271628|ref|YP_007844907.1| type VI secretion ATPase, ClpV1 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MENPAILLRRLNPYCARAMEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDMDTIWQDML
GFLDSLPRSVRSRPQLSEGVKSLMQDAWLHASLSGEEHIRSIHLLMALVEKPKLLRCDGLWPLLTLAQSQ
LERLRGLLDAQSDERPEVQQEAELTQGDEVEFVGRPVNADITGELNPALQNALDRFTLDVTARAREGRID
PVYGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIHEGNVPDALKPVSVRTLDLGLLQAG
AGVKGEFEQRLKNIIDAVQQSPLPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRTIAATTWSE
YKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAEHHGVHITDKAVKAAVTLSRRYLTGRQLPD
KAVDLLDTASARVRMSLDTIPEPLTRMKAQLTALAMEKQALLEDIAVGNTAHGERLAAIGEEEVAIILQL
DERETRYGQELKLTEELLACRTDISRQGEIADLQMQLTAVQQNTPLLGLDVDARTVATVIADWTGVPLSS
LMKDEQTELLSLEHSLAKRVVGQDSALNAIAQRLRASKTGLAPENGPQGVFLLVGPSGTGKTETALALAD
ELFGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLF
YQVFDRGVMRDGEGREIDFRNTVILMTSNLGSDLIMQLLDEQPEATEPDLHELLRPVLRDHFQPALLARF
QTVIYRPLAKAAMRTIVEMKLAQVSKRLNRHYGMKTDIHESLYDALTDACLLPDTGARNVDSLLNQQILP
VLSQQLLMHMAAKQKSHTLTLGWDEEEGIVLEFDRTQGVHA
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|479270911|ref|NC_021046.1|:941760-944405 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGAAAATCCAGCCATCCTGTTACGCCGTCTTAACCCTTACTGTGCCCGCGCAATGGAAGGGGCCGCTT
CCCTGTGCCAGACCCGCGCCCATGCGGAAATCCTGCCTGAGCACTGGCTGCTGAAACTGCTGGAACAGGG
TGAGGGCGACCTGACGGTGCTGGCGCGGCGCTACGAATGGGATATGGATACGATATGGCAGGATATGCTG
GGTTTTCTGGACAGCCTGCCACGGTCGGTGCGCAGCCGTCCGCAGCTTTCGGAGGGCGTGAAGTCCCTTA
TGCAGGACGCCTGGCTGCACGCCTCGCTGTCGGGGGAAGAGCACATCCGCAGCATTCACCTCCTGATGGC
TCTGGTGGAAAAACCGAAACTGCTGCGCTGCGACGGCCTGTGGCCGCTGCTGACGCTGGCGCAGAGCCAG
CTTGAGCGCCTGCGTGGACTTCTGGATGCGCAGTCGGATGAACGACCGGAGGTGCAGCAGGAAGCGGAGC
TTACGCAGGGGGATGAGGTGGAGTTTGTCGGCCGTCCGGTGAATGCGGATATAACAGGAGAGCTGAACCC
GGCGTTGCAGAATGCGCTGGACAGGTTCACCCTCGACGTCACCGCCCGCGCCCGTGAGGGCAGAATCGAC
CCGGTCTATGGCCGCGACAATGAAATCCGCCAGATGGTGGACATTCTTTCCCGGCGCCGCAAGAACAACC
CGATTCTGGTCGGCGAACCGGGCGTCGGCAAGACCGCGCTCGTGGAAGGACTGGCGCTGCGCATTCATGA
GGGCAATGTGCCGGACGCGCTGAAGCCGGTCTCCGTGCGCACCCTTGACCTCGGCCTGTTACAGGCCGGG
GCGGGTGTGAAGGGGGAATTCGAGCAGCGCCTGAAAAACATCATCGACGCGGTGCAGCAGTCACCCCTGC
CGGTTCTGCTCTTCATTGACGAGGCGCACACCATTATCGGCGCGGGCAACCAGGCGGGCGGCGCCGATGC
GGCCAACCTGCTGAAACCGGCGCTGGCCCGCGGTGAGCTCAGAACCATTGCCGCCACCACCTGGAGCGAA
TACAAACAGTACTTTGAGCGCGACGCCGCGCTGGAGCGTCGTTTCCAGATGGTTAAAGTTGATGAACCGG
ACGACGACACCGCCTGCCTGATGCTGCGCGGACTCAAGTCACGCTACGCGGAGCACCATGGCGTGCATAT
TACCGATAAGGCAGTTAAAGCCGCCGTCACGCTCTCCAGACGCTATCTGACCGGACGCCAGCTTCCGGAC
AAGGCGGTGGATTTGCTGGATACCGCCTCTGCCCGTGTCCGTATGAGCCTGGACACTATTCCAGAGCCGC
TGACCCGCATGAAGGCGCAGCTCACGGCCCTTGCTATGGAGAAGCAGGCGCTGCTGGAGGATATCGCGGT
GGGCAATACCGCCCACGGCGAACGTCTGGCCGCCATCGGAGAGGAAGAAGTCGCCATCATTTTGCAGCTC
GACGAACGGGAAACCCGGTACGGCCAGGAGCTGAAACTGACGGAAGAACTGCTTGCCTGCCGCACGGATA
TCTCCCGTCAGGGGGAGATTGCGGACCTTCAGATGCAGCTTACTGCCGTGCAGCAGAATACCCCGCTGCT
GGGGCTGGATGTGGACGCGCGTACCGTCGCCACCGTTATCGCCGACTGGACGGGCGTACCGCTCTCTTCC
CTGATGAAGGACGAGCAGACGGAACTGCTGAGCCTTGAGCACAGTCTGGCGAAACGCGTTGTCGGTCAGG
ACAGTGCGCTGAATGCCATTGCGCAACGCCTGCGCGCCAGCAAAACCGGTCTGGCGCCTGAGAACGGCCC
GCAGGGCGTGTTCCTGCTTGTGGGGCCGAGCGGCACCGGCAAGACCGAAACCGCACTGGCGCTGGCCGAT
GAACTGTTCGGCGGCGAGAAGTCCCTTATCACCATCAACCTTTCGGAATACCAGGAGCCACACACCGTTT
CGCAGCTCAAGGGCTCACCTCCGGGCTACGTGGGTTACGGTCAGGGCGGCATTCTGACCGAAGCCGTCCG
TAAGCGCCCGTACAGCGTGGTGCTGCTGGATGAAGTGGAAAAGGCGCACCGGGACGTGATGAACCTGTTC
TACCAGGTGTTTGACCGGGGCGTCATGCGCGACGGCGAGGGGCGGGAAATTGACTTCCGCAACACGGTGA
TTCTGATGACCTCCAATCTCGGCAGCGACCTTATCATGCAGCTGCTGGATGAACAGCCGGAGGCGACAGA
GCCGGACCTGCATGAACTGCTGCGTCCTGTCCTGCGGGACCACTTCCAGCCCGCGCTGCTGGCGCGCTTC
CAGACGGTGATTTACCGTCCGTTGGCAAAGGCAGCGATGCGTACCATTGTGGAGATGAAGCTGGCGCAGG
TCAGTAAACGCCTCAACCGTCACTACGGTATGAAGACCGATATCCACGAAAGCCTGTACGACGCGCTGAC
CGATGCCTGCCTGCTGCCGGACACCGGGGCACGCAATGTTGACAGCCTGCTGAACCAGCAGATTCTGCCG
GTGCTGAGCCAGCAACTGCTGATGCATATGGCCGCGAAACAGAAGTCGCATACCCTGACGCTCGGCTGGG
ATGAGGAAGAGGGCATAGTGCTCGAGTTTGACCGGACACAAGGAGTGCACGCATGA