SecReT6
Protein ID: 479271629
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_08970
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]944402..946894 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDD6DQR1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-62, Aligned region: 34..356
DUF2345 [PF10106], Evalue: 3.70E-38, Aligned region: 608..757
T6SS_Vgr [PF13296], Evalue: 3.60E-34, Aligned region: 489..594
T6SS_Vgr [PF13296], Evalue: 3.60E-34, Aligned region: 630..658
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 343..358
Phage_base_V [PF04717], Evalue: 1.30E-16, Aligned region: 389..482
Protein Sequence: 830 a.a.     [Download]
>gi|479271629|ref|YP_007844908.1| type VI secretion system Vgr family protein [Enterobacter cloacae subsp. cloacae NCTC 9394]
MSSNPPLRFSHSHHLLSVKGCDAGLDVLAFEGDEALSTPFSYRIEFTSTDHAISKEMMLMKAASLTLQAP
VDQGYGIKIQQPVRVIQGVVTGFERLGTSKDETRYAVTLEPRLALLSRSHQNAVYQDMSVPQIVEKILRE
RHGMRGQDFLFSLSKEYPRREQVMQYAEDDLHFITRLLGEVGIWFRFTTDTRLNIDVVEFYDSQQGYEKG
VTLPSVPPSGQHSQGVDSVWEMESHHNVVQKAVSTRDYNYRQATQDMNTLVDATRGDATTYGDAYHWADN
YLTAGSAYDRNPAAESGAFYARIRHERYLNDQTQTVAFTSCPELSPGMLLKVTGGYEVADVFAQGVVVTA
MHSHAQRDADFCVRFDGIPDSPDFSFRPEPGSRPVMAGTLPARVTSTTENDTYGHIDKDGRYRVNMLFDR
ENWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYIAGVLHDSAHGDHVTIRNYRRN
VLRTPVNNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSEKQQRGEGFELRTDSRGAIRAQKGIFISA
DGQAKAQGQVLDMEPALARLSAALVEMESLAACAQQAQALAADVGRQQKLLKQKIEQLHEEVILGSAPKG
MALVSGEDMQLSASDNMTLTAGKQLDVGAQNDFTLAAGKQLSLYSREGAKLFSSQNDIDIQAQGGNITTW
STQDTHVSSGRKMVITAQDELTLICGGGYIKISGGNVEIGGPGKLLIKNTGVRKAGTGSMQGVMKSFEPS
TFDEKFVIRNALTQEPLLGKAYKITMPNGSVVTGITDAQGATTLNSSDLIDDMIITLTGR
 
Nucleotide Sequence: 2493 bp     [Download]
>gi|479270911|ref|NC_021046.1|:944402-946894 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGAGCAGCAATCCCCCGCTAAGATTCAGCCACAGCCATCACCTGCTTTCGGTGAAGGGCTGCGATGCAG
GGCTTGATGTGCTGGCGTTTGAGGGTGATGAAGCCCTGAGCACACCCTTCAGCTACCGTATTGAGTTCAC
CAGCACGGACCATGCCATCAGCAAAGAGATGATGCTGATGAAAGCGGCTTCCCTGACGCTTCAGGCCCCG
GTTGACCAGGGTTACGGCATCAAAATACAGCAGCCGGTGCGGGTGATTCAGGGCGTGGTCACGGGTTTTG
AACGTCTGGGTACCTCAAAGGATGAAACCCGTTACGCAGTGACGCTTGAGCCGCGTCTGGCCCTGCTCAG
CCGCTCGCACCAGAACGCCGTCTACCAGGACATGTCCGTCCCGCAGATTGTGGAGAAAATCCTGCGCGAG
CGCCACGGCATGCGCGGCCAGGACTTCCTGTTCTCACTCTCAAAAGAGTACCCGCGCCGCGAGCAGGTGA
TGCAGTATGCTGAGGACGACCTGCACTTTATCACCCGCCTGCTGGGTGAGGTCGGTATCTGGTTCCGCTT
CACCACCGACACACGCCTCAACATTGACGTGGTGGAGTTTTACGACAGCCAGCAGGGATATGAGAAAGGC
GTGACGCTGCCGTCGGTGCCGCCGTCAGGGCAGCACTCGCAGGGTGTGGACTCGGTGTGGGAAATGGAGA
GCCACCATAATGTGGTGCAGAAGGCGGTCAGCACCCGCGACTACAACTACCGTCAGGCCACGCAGGACAT
GAACACCCTGGTTGATGCGACCCGCGGGGATGCCACCACGTACGGAGATGCCTATCACTGGGCGGATAAC
TACCTGACGGCGGGCAGCGCGTATGACCGCAACCCGGCAGCGGAGTCCGGTGCGTTTTACGCCCGCATCC
GTCACGAACGCTACCTGAATGACCAGACGCAGACCGTTGCCTTCACCAGTTGTCCGGAGCTCTCTCCGGG
TATGCTGCTGAAAGTCACCGGCGGGTACGAAGTGGCCGACGTGTTTGCGCAGGGCGTGGTTGTCACGGCG
ATGCACAGCCATGCGCAGCGTGATGCGGACTTTTGCGTCAGGTTTGACGGTATCCCGGACAGCCCGGATT
TCAGTTTTCGCCCTGAGCCTGGTTCACGTCCGGTGATGGCCGGTACCTTACCGGCCCGCGTCACGAGTAC
CACTGAAAATGACACCTACGGGCATATCGATAAAGACGGCCGCTACCGCGTCAACATGCTGTTTGACCGT
GAGAACTGGGAGACCGGGTTCGAGAGCCTGTGGGTCCGTCAGTCCCGCCCGTATGCAGGGGACACGTACG
GCCTGCACCTGCCGCTGCTGGCAGGCACCGAAGTGGCGATTGGCTTTGAGGACGGCAACCCGGACCGGCC
GTACATTGCCGGTGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCCGCAACTACAGACGTAAC
GTCCTGCGCACGCCGGTGAACAACAAAATTCGCCTGGATGATGAACGCGGAAAAGAGCATATCAAGGTCA
GCACGGAGTACGGCGGCAAGAGCCAGCTGAATCTCGGCCACCTGGTCGACAGCGAGAAACAACAGCGTGG
CGAGGGGTTTGAGCTCAGGACGGACAGCCGGGGCGCCATCCGGGCGCAGAAGGGGATTTTTATCAGTGCT
GACGGCCAGGCGAAGGCGCAGGGCCAGGTCCTTGATATGGAGCCTGCACTCGCACGGCTTTCAGCAGCAT
TAGTGGAAATGGAATCCCTTGCTGCCTGCGCACAGCAGGCTCAGGCTCTGGCTGCCGATGTTGGCCGTCA
GCAAAAACTCCTGAAGCAGAAAATTGAACAACTGCATGAAGAGGTGATTCTGGGCAGTGCGCCAAAAGGC
ATGGCACTGGTGAGCGGCGAAGATATGCAGCTATCAGCCAGTGATAATATGACACTGACAGCGGGTAAAC
AGCTGGATGTTGGTGCGCAGAATGACTTTACGCTGGCGGCCGGTAAGCAACTCAGCCTTTACAGCCGTGA
AGGGGCAAAACTGTTCAGCTCGCAAAACGACATTGATATTCAGGCGCAGGGCGGAAACATCACCACATGG
TCCACACAGGATACGCATGTTTCAAGCGGCAGGAAAATGGTCATTACAGCACAGGACGAGCTGACGCTGA
TATGCGGAGGCGGCTACATCAAAATCAGCGGTGGGAATGTTGAGATTGGTGGTCCGGGTAAACTGCTGAT
TAAGAACACGGGCGTCAGGAAAGCGGGCACGGGCAGTATGCAGGGGGTGATGAAGTCGTTTGAACCTTCT
ACGTTTGATGAGAAATTTGTTATCAGAAATGCATTAACCCAAGAGCCGCTTCTAGGAAAAGCCTATAAAA
TAACTATGCCAAACGGGTCAGTTGTCACTGGTATAACAGACGCGCAGGGGGCAACGACGCTTAATTCTTC
GGATTTGATAGATGATATGATAATAACACTTACTGGTCGTTAA