SecReT6
Protein ID: 479271634
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_09050
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]957564..959165 [+]
Producttype VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDD6DQR6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.40E-22, Aligned region: 67..126
ImpA-rel_N [PF06812], Evalue: 5.40E-22, Aligned region: 460..478
Protein Sequence: 533 a.a.     [Download]
>gi|479271634|ref|YP_007844913.1| type VI secretion-associated protein, VC_A0119 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MDALLNLVVACQADETLLRQQAQSRMESWQRWLTPISEINPTGEDPGYDDDFQRIREEVNKLSGIDTGLI
CQLAEKVLTTEAKDVRVATYYCWARLHQDGETGFAEGLELLAGLLTQYGTQLHPQRERSRKPALEWLAGS
RLLDSLLLWPEVVRDDAQRTTGALLLIRDSLETEPEASRPDLSALYSALGSRLMKAGGVDAVIPQNASSQ
TRPQSASHTAEQDAPVLSRITSGQDLLAQARTLTGYLREQPDGWLAAHRLMKSLRHDTLRAIPAPDAEGK
TRIEPPRADQRAMLKRLYLQQSWLEILEQADSTFSRGANHLWLDLQWYIHQALIKSGQDVLADIITADLK
GLLRRLPGLETLAFNDGTPFTDEVTLNWINQSVLDEMSNWRDESVSALSETGNDILALEPEALEKADTDG
LDATLHWLQTRPGTDTTKDKWLVRLLMARVAEQKGRNELALHLLGELDGAAQAITLTQWTPALLFEVKSR
RLRLLRMKAARSETDKSRLQPEMDQLLAGLIALDPAGCAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|479270911|ref|NC_021046.1|:957564-959165 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGACGCTTTGCTGAATCTGGTTGTTGCCTGCCAGGCGGATGAAACCTTGCTGCGACAGCAGGCGCAGT
CACGTATGGAAAGCTGGCAGCGCTGGCTTACCCCTATCAGTGAGATCAATCCTACAGGAGAAGACCCGGG
TTATGACGATGATTTCCAGCGTATCCGGGAGGAGGTCAATAAACTTTCCGGCATTGATACCGGGCTGATT
TGCCAGCTGGCTGAAAAGGTGCTGACCACAGAGGCCAAAGATGTCCGGGTTGCTACTTACTATTGTTGGG
CGCGCTTGCACCAGGACGGTGAAACCGGGTTTGCTGAAGGGCTTGAGTTACTGGCGGGATTACTAACCCA
GTATGGAACACAGCTCCATCCTCAGCGCGAGCGAAGCCGTAAACCGGCGCTGGAGTGGCTCGCAGGCTCT
CGTCTACTTGACAGCCTGTTACTCTGGCCAGAAGTGGTACGCGACGATGCCCAGCGTACGACCGGTGCGT
TGCTGCTCATCCGAGACAGTCTTGAAACTGAGCCGGAAGCGTCACGTCCAGATCTGAGTGCCCTGTACAG
CGCGCTGGGATCCCGCCTGATGAAAGCCGGTGGCGTGGATGCGGTAATACCCCAGAATGCCAGCAGTCAG
ACACGCCCGCAGTCGGCATCTCACACGGCAGAACAGGACGCGCCAGTGCTGAGCCGCATCACGTCCGGTC
AGGATTTGCTGGCTCAGGCCCGAACCCTAACGGGATATTTGCGTGAGCAACCTGATGGCTGGCTTGCCGC
ACACCGGCTGATGAAAAGTCTGCGTCACGACACGCTAAGAGCAATCCCGGCACCGGATGCCGAAGGGAAA
ACGCGCATCGAACCGCCGCGGGCTGACCAGCGTGCAATGCTTAAACGGCTGTATTTGCAACAGAGCTGGC
TGGAGATACTGGAACAAGCGGACAGCACTTTCTCGCGTGGCGCCAATCATCTCTGGCTGGATTTGCAGTG
GTACATCCATCAGGCCCTGATTAAATCAGGCCAGGATGTGCTGGCCGATATCATTACCGCTGACCTGAAA
GGGCTGCTGCGGCGCCTTCCTGGACTTGAAACGCTGGCCTTCAATGACGGCACACCCTTTACTGATGAGG
TCACGCTGAACTGGATAAACCAGAGCGTGCTCGACGAGATGTCCAACTGGCGGGATGAGTCTGTCAGTGC
CTTGAGTGAAACTGGCAACGATATTCTGGCCCTTGAACCGGAAGCACTGGAGAAAGCTGACACGGATGGT
CTGGATGCCACACTCCACTGGCTGCAAACGCGCCCGGGCACCGACACCACAAAAGACAAATGGTTGGTGC
GCCTGCTGATGGCACGTGTGGCGGAGCAGAAGGGTAGGAATGAACTGGCCCTGCATCTGCTGGGTGAACT
TGACGGTGCAGCACAGGCCATCACCCTCACTCAGTGGACACCGGCGCTGTTGTTTGAAGTGAAATCGCGC
CGCCTCAGGCTGCTGCGTATGAAAGCCGCCCGCAGTGAAACCGATAAGTCACGGCTTCAGCCAGAGATGG
ACCAGCTTCTGGCGGGCCTGATTGCCCTTGACCCGGCAGGCTGTGCGGTACTTTGCGGGTAA