SecReT6
Protein ID: 479271635
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_09060
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]959207..960961 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDD6DQR7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.70E-181, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|479271635|ref|YP_007844914.1| type VI secretion protein, VC_A0110 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MDDLTLRYYDAEMRYLLEAGEEFARAHPEQAAMLNLDKAGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSMSVVEFTPVWREMKEPMRIARGFEVNSRPIGEKGTRCRYTTTKEITLQPLA
LEHARLSTDPDGRSVISLRFSCSHLADWSRVDLSQIPFYFNADAPLACAMHEAFTMNTARLWLRMPGDMD
RRPMDGYFTALGFGDDDRLWPKGDSSFSGYQLLLEYFTFREKFMFTGLRGLESVVFPAEIPWFEIDVVLA
ERWEHDFSFTEKHLRLNCVPVINLFPLESDPLTLNSLQTEYMLRPMRVQDGHTEIYTVDSVMSSSQHTYV
PFSSFRHKGGMMRHEAPEYYYHTRVRRGPSGLHNTWLILGGEAFDNHTVPEDESLSLTLTGTNGQLPRRA
LQSTVLDTVMKTTSVSIAVRNLCAPTLPCYPPAQDRFHWRVLSHLGSGFLSMMDNADVLRGTLALYEWTD
SEMNRRRLEAILEVKHSETERFEQGYLVRGVQIEVTLDSNGFAGRGDICLFGEMMSRFFALYTDIYLFNR
LIIILQPTGERLEWEEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|479270911|ref|NC_021046.1|:959207-960961 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGACGACTTAACCCTGCGTTATTACGACGCTGAAATGCGCTACCTGCTGGAAGCCGGCGAAGAATTTG
CCCGCGCTCACCCTGAACAGGCGGCAATGCTCAATCTCGATAAAGCGGGCGCGCGCGACCCGTACGTGGA
GCGACTGTTCGAGGGCTTTGCCTTTCTGATGGGCCGCCTGCGTGAGAAGCTTGATGACGACCTGCCTGAA
CTGACTGAAGGGCTGGTCAGTCTGCTATGGCCGCATTACCTGCGCACTATTCCCTCGATGTCGGTGGTGG
AGTTCACTCCTGTCTGGCGTGAGATGAAAGAACCGATGCGTATTGCCAGAGGTTTCGAGGTCAATTCGCG
GCCGATCGGTGAAAAAGGCACGCGTTGTCGCTACACCACAACTAAAGAGATAACCCTTCAGCCACTGGCG
TTGGAGCATGCCCGCCTGTCGACTGATCCTGACGGGCGCTCTGTCATCAGCCTGCGCTTCAGTTGTAGCC
ATCTTGCTGACTGGAGCCGTGTCGATCTCAGCCAGATCCCGTTCTATTTCAACGCTGACGCACCGCTGGC
CTGCGCTATGCATGAAGCTTTTACCATGAATACTGCGCGTCTGTGGCTGCGCATGCCGGGCGACATGGAC
AGAAGGCCGATGGACGGGTATTTCACCGCACTGGGGTTTGGTGATGATGACAGGCTGTGGCCGAAGGGGG
ACAGCAGTTTCAGCGGTTACCAGTTGCTGCTGGAGTACTTCACCTTTCGCGAGAAATTCATGTTTACGGG
GCTGCGCGGGCTGGAGAGCGTGGTCTTTCCGGCTGAGATCCCGTGGTTTGAAATCGACGTGGTGCTGGCG
GAACGCTGGGAGCATGACTTCAGCTTTACCGAAAAGCACCTGCGCCTGAATTGCGTGCCGGTCATTAACC
TGTTCCCGCTGGAATCCGATCCGCTGACGCTCAATTCTCTGCAAACCGAATACATGCTGCGCCCGATGCG
CGTGCAGGATGGCCATACCGAGATATATACCGTGGATTCGGTGATGTCATCGAGCCAGCACACCTACGTG
CCGTTTTCGAGCTTCCGTCATAAGGGAGGAATGATGCGTCATGAAGCACCGGAATATTACTACCACACCC
GCGTGCGCCGCGGTCCGTCCGGCCTGCATAACACCTGGCTCATCCTTGGCGGCGAAGCATTTGATAATCA
TACCGTCCCGGAAGACGAAAGCCTGTCGCTGACGCTCACCGGCACCAATGGTCAACTGCCACGACGTGCG
CTGCAAAGCACCGTGCTTGATACGGTGATGAAAACCACTTCGGTCAGCATTGCCGTGCGCAACCTGTGTG
CGCCGACGCTGCCTTGTTACCCACCTGCGCAGGACCGTTTTCACTGGCGCGTACTGAGTCACCTTGGCAG
CGGATTTCTGTCGATGATGGATAATGCCGACGTGCTGCGCGGTACCCTGGCGCTGTATGAATGGACCGAC
AGCGAGATGAACCGTCGCCGTCTGGAAGCTATCCTCGAGGTGAAGCACAGTGAAACGGAGCGCTTTGAAC
AGGGCTACCTGGTCCGTGGCGTGCAGATTGAAGTCACGCTGGACAGCAATGGCTTTGCCGGACGCGGCGA
CATCTGCTTATTTGGCGAGATGATGAGCCGATTCTTTGCGCTATACACTGACATCTACTTGTTTAACCGC
CTGATTATCATTCTGCAACCGACCGGAGAACGCCTGGAATGGGAAGAGAAGCACAACCGCCGCATTCCCG
GCTGA