SecReT6
Protein ID: 479271636
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_09070
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]960925..962010 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDD6DQR8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-76, Aligned region: 18..320
Protein Sequence: 361 a.a.     [Download]
>gi|479271636|ref|YP_007844915.1| type VI secretion protein, VC_A0111 family [Enterobacter cloacae subsp. cloacae NCTC 9394]
MGREAQPPHSRLSPRLEADLHRINFYRLCQLLEKRNPGRPLMGSTSHPGDDPVRFAPHPGMGFPASELKA
VEYDEDDDSRPPLIRTTFMGMYGVDSPLPMAYLDDIAQRREGHDALQGFLDIFSHRILTQFYRIWRKYSY
PATFEPGGTDSISQSLLGLVGLGIPGTADHIATPVSRFLALLGVLQQPGKTQEGMQALVTLLAPDTTVRV
SPYCLRPVEIGQPLGFYGDDDFLLDGNTPLGDEAMDAGSQLLVALTTDNEQEAQGWKPDGLLYQDFLVML
RVYLGWRFKAKITLTTRTRLLAVPPLGEGPLWLGMNGVLGADEGELKDDIPPTFTTELGYYTGLKLAIPQ
QGNRRVTYKFD
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|479270911|ref|NC_021046.1|:960925-962010 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGGGAAGAGAAGCACAACCGCCGCATTCCCGGCTGAGCCCACGGCTGGAAGCCGACCTGCATCGTATTA
ACTTTTACCGTTTATGCCAGTTGCTGGAGAAGCGTAACCCGGGCAGGCCGCTGATGGGCTCGACCAGTCA
CCCGGGCGATGACCCGGTACGCTTTGCCCCGCATCCGGGCATGGGATTTCCGGCCAGTGAGCTGAAAGCC
GTGGAGTATGATGAGGATGATGACAGCCGGCCACCACTTATCCGCACGACCTTTATGGGAATGTACGGTG
TCGACTCACCCCTGCCGATGGCGTATCTCGATGACATCGCTCAGCGTCGGGAAGGGCATGACGCACTACA
GGGTTTTCTGGATATTTTCAGCCATCGCATTCTGACGCAGTTTTACCGTATCTGGCGTAAATACTCTTAT
CCGGCCACCTTTGAACCCGGTGGTACGGACAGCATCTCGCAGTCACTGCTGGGCCTGGTGGGATTGGGTA
TTCCCGGCACAGCAGACCACATTGCCACACCGGTATCCCGTTTTCTGGCTCTGCTGGGTGTTCTACAGCA
ACCGGGCAAAACTCAGGAGGGAATGCAGGCGCTGGTGACGTTGCTGGCCCCGGATACCACCGTGAGGGTC
AGTCCATACTGCCTGCGGCCGGTGGAAATTGGTCAGCCGCTGGGCTTTTACGGTGATGACGATTTTCTGC
TGGACGGCAACACGCCACTGGGTGACGAAGCGATGGATGCGGGTAGCCAACTGCTGGTTGCGCTTACAAC
GGATAATGAACAGGAGGCACAGGGCTGGAAGCCGGACGGTCTGCTGTATCAGGATTTTCTGGTCATGCTG
CGGGTATATCTTGGCTGGCGTTTTAAGGCGAAGATCACCCTGACCACCCGGACCCGACTGCTGGCTGTTC
CGCCACTTGGCGAAGGCCCTCTCTGGCTCGGGATGAACGGCGTGCTGGGGGCTGATGAGGGGGAACTTAA
AGACGATATCCCACCGACCTTTACGACGGAACTGGGCTATTACACCGGCCTGAAGCTGGCAATACCACAA
CAAGGAAACCGACGTGTTACGTACAAGTTTGATTAA