SecReT6
Protein ID: 479271637
SecReT6 ID752
T6SS typei2
Gene symbol-
Locus tagENC_09090
StrainEnterobacter cloacae subsp. cloacae NCTC 9394
Repliconchromosome [GenBank: NC_021046] [Browse all T6SS(s) in this replicon]
Location [Strand]962533..962988 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDD6DQR9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-15, Aligned region: 31..117
Protein Sequence: 151 a.a.     [Download]
>gi|479271637|ref|YP_007844916.1| type VI secretion system lysozyme-related protein [Enterobacter cloacae subsp. cloacae NCTC 9394]
MPKGHNTPSLYEMLSGNFSGGLSLNQVSEQNQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTKILQGM
PGTAHQLITTLSAILLKYEPRLSRINVVMQEQIQPGELRYAIDAELKGVGLVRYGTEFMPEGRVLIRHLK
QQQYLDARAAI
 
Nucleotide Sequence: 456 bp     [Download]
>gi|479270911|ref|NC_021046.1|:962533-962988 Enterobacter cloacae subsp. cloacae NCTC 9394 draft genome
ATGCCTAAGGGACATAATACGCCATCGCTGTATGAAATGCTGAGCGGTAATTTCTCAGGTGGCCTGAGCC
TCAACCAGGTCAGCGAACAGAATCAGGTGATTTTATCAGTACTCGATAACATGCAGCGCATCCTCAACTG
CCGCGCCGGTACGCTGGCTCACTTGCCGGACTACGGCCTGCCGGATATGACAAAAATCCTCCAGGGAATG
CCCGGTACCGCCCATCAGCTGATTACCACACTGTCGGCCATATTGCTGAAATATGAGCCGCGCCTGAGCC
GGATTAACGTGGTGATGCAGGAACAGATTCAGCCCGGTGAACTCCGCTACGCCATTGATGCGGAGCTGAA
GGGGGTCGGGCTGGTGCGCTACGGCACGGAATTTATGCCCGAGGGCAGGGTATTAATCCGTCATCTGAAA
CAACAGCAATACCTCGATGCACGAGCCGCCATCTAG