SecReT6
Protein ID: 482894209
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50860
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5156199..5158727 [+]
ProductAAA ATPase
NoteTssH
UniProt IDM9Y6Q3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.20E-38, Aligned region: 213..289
AAA_2 [PF07724], Evalue: 4.20E-38, Aligned region: 604..768
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 213..324
AAA [PF00004], Evalue: 1.10E-19, Aligned region: 610..727
AAA_5 [PF07728], Evalue: 7.70E-16, Aligned region: 213..233
AAA_5 [PF07728], Evalue: 7.70E-16, Aligned region: 284..343
AAA_5 [PF07728], Evalue: 7.70E-16, Aligned region: 609..728
Clp_N [PF02861], Evalue: 1.80E-10, Aligned region: 21..72
Clp_N [PF02861], Evalue: 1.80E-10, Aligned region: 108..122
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 213..298
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 331..377
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 607..713
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 26..75
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 139..170
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 190..234
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 257..291
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 428..520
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 476..548
AAA_16 [PF13191], Evalue: 4.90E-08, Aligned region: 593..653
AAA_19 [PF13245], Evalue: 8.20E-07, Aligned region: 210..237
AAA_19 [PF13245], Evalue: 8.20E-07, Aligned region: 607..632
AAA_19 [PF13245], Evalue: 8.20E-07, Aligned region: 751..767
AAA_17 [PF13207], Evalue: 2.30E-06, Aligned region: 213..255
AAA_17 [PF13207], Evalue: 2.30E-06, Aligned region: 461..461
AAA_17 [PF13207], Evalue: 2.30E-06, Aligned region: 610..647
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 213..293
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 608..699
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 213..286
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 425..476
AAA_25 [PF13481], Evalue: 1.30E-05, Aligned region: 607..634
Zeta_toxin [PF06414], Evalue: 1.80E-05, Aligned region: 213..233
Zeta_toxin [PF06414], Evalue: 1.80E-05, Aligned region: 601..649
Sigma54_activat [PF00158], Evalue: 1.90E-05, Aligned region: 210..229
Sigma54_activat [PF00158], Evalue: 1.90E-05, Aligned region: 608..726
IstB_IS21 [PF01695], Evalue: 3.80E-05, Aligned region: 207..232
IstB_IS21 [PF01695], Evalue: 3.80E-05, Aligned region: 609..629
ClpB_D2-small [PF10431], Evalue: 0.00013, Aligned region: 774..841
AAA_18 [PF13238], Evalue: 0.00036, Aligned region: 213..233
AAA_18 [PF13238], Evalue: 0.00036, Aligned region: 611..637
AAA_18 [PF13238], Evalue: 0.00036, Aligned region: 782..801
T2SE [PF00437], Evalue: 0.00048, Aligned region: 195..229
T2SE [PF00437], Evalue: 0.00048, Aligned region: 595..687
NACHT [PF05729], Evalue: 0.00061, Aligned region: 213..239
NACHT [PF05729], Evalue: 0.00061, Aligned region: 473..518
NACHT [PF05729], Evalue: 0.00061, Aligned region: 609..635
SRP54 [PF00448], Evalue: 0.0021, Aligned region: 213..233
SRP54 [PF00448], Evalue: 0.0021, Aligned region: 356..385
SRP54 [PF00448], Evalue: 0.0021, Aligned region: 608..643
AAA_29 [PF13555], Evalue: 0.0024, Aligned region: 204..229
AAA_29 [PF13555], Evalue: 0.0024, Aligned region: 605..634
ResIII [PF04851], Evalue: 0.0026, Aligned region: 199..233
ResIII [PF04851], Evalue: 0.0026, Aligned region: 283..294
ResIII [PF04851], Evalue: 0.0026, Aligned region: 609..631
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 214..234
RNA_helicase [PF00910], Evalue: 0.0029, Aligned region: 610..631
AAA_28 [PF13521], Evalue: 0.004, Aligned region: 213..232
AAA_28 [PF13521], Evalue: 0.004, Aligned region: 369..390
AAA_28 [PF13521], Evalue: 0.004, Aligned region: 461..524
AAA_28 [PF13521], Evalue: 0.004, Aligned region: 609..629
FtsK_SpoIIIE [PF01580], Evalue: 0.0048, Aligned region: 192..240
FtsK_SpoIIIE [PF01580], Evalue: 0.0048, Aligned region: 433..507
FtsK_SpoIIIE [PF01580], Evalue: 0.0048, Aligned region: 609..630
Torsin [PF06309], Evalue: 0.0074, Aligned region: 566..632
AAA_23 [PF13476], Evalue: 0.0088, Aligned region: 213..230
AAA_23 [PF13476], Evalue: 0.0088, Aligned region: 445..445
AAA_23 [PF13476], Evalue: 0.0088, Aligned region: 607..634
AAA_33 [PF13671], Evalue: 0.01, Aligned region: 213..230
AAA_33 [PF13671], Evalue: 0.01, Aligned region: 568..599
AAA_33 [PF13671], Evalue: 0.01, Aligned region: 608..630
Protein Sequence: 842 a.a.     [Download]
>gi|482894209|ref|YP_007895957.1| AAA ATPase [Azotobacter vinelandii CA]
MELGTLIGRLDSDCRRALERAAQRCLQRTHHYVEIEHLLLELLDIEGGDLARVLPRFGLERDTVAGEINR
ALELFKAGSTRTPALSPNLIGLLEDAVVHASLQNQPSIRSGLLLLALLDREERRSLLLNSASSLLRIPRE
ALRNQLAECSRERPARPSQDKTDASAEDGFLAQYTQDLTADARAGRIDPIVGRDGEIRQSIDILLRRRQN
NPILVGAPGVGKTAVVEGLALRIAAGDVPPPLQNVEVRVLDLGLLQAGAGVKGEFEQRLKGVIDGVRNAE
RPVILFIDEAHTLIGAGGAEGGSDAANLLKPALARGELRTLAATTWLEYKKYFEKDPALARRFQLVQVEE
PDEATAVEMLRGVAAKLEQHHGVLVLDAAIQDAVKLSHRYISGRQLPDKAISVLDTACARVALGQHDVPP
PLESLRHRQQALKEELDRLRREQTTGLDHRERITALEHEAAGNTVAIRELEGRWQEEREAVRALLEARRE
LLALSDNADASNSDEELDGRIDHLAAELLRLEAGLEAIRQDDPLVPEQVDSKAVAAVIASWTGIPVGKML
ADEVHAVRTLGQRLAQRVMGQDAALATIAQRIQAYRAGLTDPQKPVGVFLLLGPTGVGKTETAYALADAL
YGGERNLIAINLSEYQEAHTVSQLKGAPPGYVGYGSGGVLTEAVRRRPYSVVLLDEIEKAHPDVLEAFYN
VFDKGVMEDGTGLVVDFKNTVILATSNVGAELILDTPADQVGGDAFNERLRSVLLQAFRPAFLARMTVVP
YRPLDTVTLESIVEAKLEKLRERYKTATGKPLELDEDIVETVLGRCASTGVRDIENLLMGEVVGKLAEWV
LK
 
Nucleotide Sequence: 2529 bp     [Download]
>gi|482892482|ref|NC_021149.1|:5156199-5158727 Azotobacter vinelandii CA, complete genome
ATGGAACTGGGCACCCTGATCGGACGCCTCGACAGCGACTGCCGCCGCGCCCTGGAACGCGCCGCCCAGC
GCTGCCTGCAACGCACCCACCATTACGTCGAGATCGAGCACCTCCTGCTGGAGTTGCTGGACATCGAGGG
TGGCGACCTGGCCCGCGTGCTGCCGCGCTTCGGCCTGGAACGCGATACCGTGGCCGGCGAGATCAACCGC
GCCCTGGAGCTGTTCAAGGCCGGCAGCACCCGCACCCCGGCGCTCTCGCCGAACCTCATCGGCCTCCTGG
AAGACGCCGTGGTCCACGCCAGCCTGCAGAACCAGCCGAGCATCCGCTCCGGCCTGCTGCTGCTCGCCTT
GCTCGACCGCGAGGAACGCCGCAGCCTGCTGCTGAACAGCGCCTCCTCGCTGCTGCGCATCCCGCGCGAG
GCCCTGCGCAACCAGCTCGCCGAGTGCTCGCGCGAGCGACCGGCCCGCCCGTCGCAGGACAAGACCGATG
CGTCGGCTGAGGACGGCTTCCTCGCCCAGTACACCCAGGATCTGACCGCCGACGCCCGCGCCGGACGCAT
CGACCCCATCGTCGGCCGCGACGGGGAAATCCGCCAGAGCATCGATATCCTGCTGCGCCGCCGGCAGAAC
AACCCGATCCTGGTCGGCGCCCCCGGCGTCGGCAAGACCGCGGTGGTCGAGGGCCTGGCCCTGCGCATCG
CCGCCGGCGACGTGCCGCCGCCCTTGCAGAACGTCGAGGTGCGCGTCCTCGATCTCGGCCTGCTGCAGGC
CGGCGCAGGGGTCAAGGGCGAATTCGAGCAGCGCCTGAAGGGCGTGATCGACGGTGTGCGCAACGCCGAG
CGGCCGGTGATCCTGTTCATCGACGAAGCCCACACCCTGATCGGCGCCGGCGGCGCCGAGGGCGGCAGCG
ATGCCGCCAACCTGCTCAAGCCGGCCCTGGCGCGCGGCGAGCTGCGCACCCTCGCCGCCACCACTTGGCT
GGAATACAAGAAGTACTTCGAGAAGGACCCGGCCCTGGCCCGGCGCTTCCAGTTGGTCCAGGTCGAGGAA
CCGGACGAGGCCACCGCGGTGGAGATGCTGCGCGGCGTCGCCGCCAAGCTGGAACAGCACCATGGCGTGC
TGGTGCTGGACGCGGCCATCCAGGACGCGGTGAAACTGTCGCACCGCTACATCTCCGGCCGCCAGTTGCC
GGACAAGGCGATCAGCGTGCTGGACACCGCCTGCGCCCGCGTAGCCCTCGGCCAGCACGACGTGCCGCCA
CCCCTGGAGAGCCTGCGCCATCGCCAGCAGGCGCTGAAGGAAGAACTCGACCGCCTGCGCCGCGAACAGA
CCACCGGCCTCGACCACCGCGAACGCATCACCGCCCTGGAGCACGAAGCAGCCGGCAATACCGTGGCGAT
CCGCGAACTGGAAGGCCGCTGGCAGGAAGAGCGCGAAGCCGTGCGCGCCCTGCTGGAGGCGCGCCGGGAA
CTGCTCGCCCTGAGCGACAATGCGGATGCCAGCAACTCCGACGAGGAACTGGACGGACGCATCGACCACC
TGGCCGCCGAACTGCTGCGCCTGGAGGCCGGCCTGGAAGCCATCCGCCAGGACGACCCGCTGGTCCCGGA
GCAGGTGGACTCCAAGGCCGTGGCCGCGGTGATCGCCAGCTGGACCGGCATCCCGGTCGGCAAGATGCTC
GCCGACGAGGTCCACGCCGTGCGCACCCTCGGCCAGCGCCTGGCGCAGCGGGTGATGGGCCAGGACGCGG
CGCTGGCCACCATCGCCCAGCGTATCCAGGCCTATCGCGCCGGCCTCACCGACCCGCAGAAGCCGGTCGG
CGTGTTCCTGCTGCTCGGCCCCACCGGCGTCGGCAAGACCGAAACCGCCTACGCCCTGGCCGACGCCCTG
TACGGCGGCGAACGCAACCTGATCGCCATCAACCTCTCCGAATACCAGGAAGCCCACACCGTCAGCCAGC
TCAAGGGCGCCCCGCCCGGCTACGTCGGCTACGGCAGCGGCGGCGTACTCACCGAAGCCGTGCGCCGCCG
CCCCTACTCGGTGGTGCTGCTCGACGAGATCGAAAAGGCCCACCCGGACGTGCTGGAGGCCTTCTACAAC
GTGTTCGACAAGGGCGTGATGGAGGACGGCACCGGCCTGGTGGTGGACTTCAAGAACACCGTGATTCTCG
CCACCAGCAACGTCGGCGCCGAACTCATCCTCGACACCCCGGCCGACCAGGTCGGCGGCGACGCCTTCAA
CGAACGCCTGCGCAGCGTCTTGCTGCAGGCCTTCCGCCCGGCCTTCCTCGCGCGCATGACCGTGGTGCCC
TACCGGCCGCTGGACACGGTGACCCTGGAAAGCATCGTGGAGGCGAAACTGGAAAAACTGCGCGAGCGCT
ACAAGACCGCGACCGGAAAACCGTTGGAACTCGACGAGGACATCGTCGAGACGGTCCTGGGCCGCTGCGC
TTCGACGGGGGTGCGGGATATCGAGAACCTGTTGATGGGGGAAGTGGTGGGAAAGTTGGCGGAGTGGGTG
TTGAAATGA