SecReT6
Protein ID: 482894210
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50850
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5155174..5156196 [+]
Producthypothetical protein
NoteTssG
UniProt IDM9Y525
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.40E-81, Aligned region: 18..320
Protein Sequence: 340 a.a.     [Download]
>gi|482894210|ref|YP_007895956.1| hypothetical protein AvCA_50850 [Azotobacter vinelandii CA]
MAATGRNAARPLSERLRREPQAFELLQALLLLEREQPRATPLGSGTAPRAEALRLRGPLTPLFAASQVQS
LENDRQDARPVLSTPVFGLGGPDGPLPYAYQEWLQQRARQKDHGPGEFLDLFQHRLLSLLYRSLRKHRVA
LGFEAPQNSPVHDQLRALTGLLPKGLRERQSLPDAAILARGALFADGRRSLAGFAAVVRQHFRLPVRAEP
YQGAWRPIPPAARSILGRGRRNLSLGRDAVAGTRIWDEHAGIRLTLGPLEPARAEAFLPDGDAHRQLACL
AALHFGPDLDCALRLLVSGARPLLLDRRAPPRLNWNGGLRRQPCAAIRHFDTRLRLPEMS
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|482892482|ref|NC_021149.1|:5155174-5156196 Azotobacter vinelandii CA, complete genome
GTGGCAGCCACAGGCCGGAATGCCGCTCGTCCTCTGAGCGAGCGCCTGCGCCGCGAGCCGCAGGCCTTCG
AGCTGCTGCAGGCACTGCTGCTGCTCGAACGCGAACAGCCGCGGGCGACGCCGCTCGGCAGCGGCACGGC
GCCGCGCGCCGAGGCGCTGCGTCTGCGCGGGCCGCTGACGCCGCTGTTCGCCGCCAGCCAGGTGCAGAGT
CTGGAGAACGACCGACAGGACGCACGACCGGTACTGAGCACTCCGGTGTTCGGCCTCGGCGGTCCCGACG
GCCCACTGCCCTACGCCTACCAGGAATGGCTGCAGCAACGGGCGCGGCAGAAGGACCACGGCCCCGGCGA
ATTTCTCGACCTGTTCCAGCACCGCCTGCTCAGCCTGCTGTACCGCAGCCTGCGCAAGCACCGTGTCGCC
CTGGGCTTCGAGGCGCCGCAGAACAGCCCGGTACACGATCAGTTGCGCGCCCTGACCGGCTTGCTGCCCA
AGGGCCTGCGCGAGCGCCAGAGCCTGCCGGACGCGGCGATCCTCGCCCGCGGCGCGCTGTTCGCCGACGG
CCGCCGCTCGCTGGCCGGCTTCGCCGCCGTCGTCCGCCAGCATTTCCGCCTGCCGGTGCGGGCCGAGCCC
TACCAGGGCGCCTGGCGCCCCATCCCGCCGGCCGCTCGCAGCATCCTCGGTCGCGGTCGCCGCAACCTGA
GCCTGGGTCGCGACGCCGTGGCCGGTACCCGGATCTGGGACGAGCACGCCGGCATCCGCCTGACCCTCGG
CCCTCTGGAGCCGGCGCGGGCCGAGGCGTTCCTGCCGGACGGCGACGCCCACCGGCAACTCGCCTGCCTG
GCCGCCCTCCACTTCGGCCCGGACCTGGACTGCGCGCTGCGCCTGCTGGTCAGTGGCGCCCGGCCGCTGT
TGCTCGATCGCCGGGCGCCGCCGCGGCTGAACTGGAACGGCGGTCTGCGCCGCCAGCCCTGCGCGGCCAT
CCGCCACTTCGATACCCGACTGCGCCTGCCGGAGATGAGTTGA