SecReT6
Protein ID: 482894211
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50840
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5153417..5155210 [+]
Producthypothetical protein
NoteTssF
UniProt IDM9Y128
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-179, Aligned region: 9..593
Protein Sequence: 597 a.a.     [Download]
>gi|482894211|ref|YP_007895955.1| hypothetical protein AvCA_50840 [Azotobacter vinelandii CA]
MSDSIDEVLLDYYQRELTWLRHAGAIFAERYPKVARRLELSPGECPDPHVERLLEGFSLLAARLQRRLDD
DYAEFSDALLEQLYPLALRPLPSCAIVQFEPDPTKGNLAEGYRLPRDTPLFVTGADGASVHFRTSAEVEL
WPLQIVEATLLAGDEACALTGVAPARSALRLSLRCLGGCRWPELPVRRLRLHLAASPMVNASLHDLLGAH
ALQMLAGVPGSLPQALPGLPQAVGFSAAEALLPDEDGLHPGLRLLAEYFAFPDKFAFFDLPVQAPSGASE
ELQLYIVFDRAPAGRLHLQAADFALGCAPLVNLFPRTSEPLRPDGTRSEYRLVADSHRENSMEIHSIRAL
RACSAEGVRQVPAYHGCQHALGESRLYWHARRVDGLTPNRLGSDLLLSLVDTRFDPQREAPDYSLTAELL
CTSRHLAEALGAGTRLDFERPGPVARARLRNPPTPQSLPRLRGESRWRLVSQLSLNHLSLVEGERALDAL
KEMLQLHNLRDEPGARRQIDGLVRLDCERIVAQVGEDAWRGWRNGLGVRLHLDPQHFVGSSAVLFSAVLA
QFFSLYASANRFVRTTLVLADKEIKTWQPQAGMPLVL
 
Nucleotide Sequence: 1794 bp     [Download]
>gi|482892482|ref|NC_021149.1|:5153417-5155210 Azotobacter vinelandii CA, complete genome
ATGAGCGACTCGATTGACGAGGTCCTGCTCGACTACTACCAGCGCGAACTGACCTGGCTGCGGCATGCCG
GCGCCATTTTCGCCGAGCGCTATCCCAAGGTCGCCCGACGCCTGGAGCTGTCTCCCGGCGAGTGCCCGGA
CCCCCATGTGGAACGCCTGCTGGAAGGCTTCTCCCTGCTCGCCGCGCGCCTGCAGCGGCGCCTCGACGAC
GACTACGCCGAGTTCAGCGACGCCCTGCTGGAACAGTTGTATCCGCTGGCCCTGCGCCCTTTGCCCTCCT
GCGCCATCGTCCAGTTCGAGCCGGACCCGACCAAGGGCAATCTCGCCGAGGGTTATCGCTTGCCGCGCGA
TACCCCGCTGTTCGTCACCGGCGCCGACGGCGCCAGCGTGCACTTCCGCACCAGCGCCGAGGTCGAGCTG
TGGCCGCTGCAGATCGTCGAGGCGACCCTCCTCGCCGGCGACGAAGCCTGCGCCCTGACCGGCGTGGCGC
CGGCCCGTTCGGCCCTGCGCCTGAGCCTGCGCTGCCTGGGCGGGTGCCGCTGGCCGGAGCTGCCCGTGCG
TCGCCTGCGCCTGCATCTGGCTGCGTCACCGATGGTCAACGCCAGCCTCCACGACCTGCTGGGCGCCCAT
GCCCTGCAGATGCTCGCCGGAGTGCCGGGCAGCCTGCCGCAGGCTTTGCCCGGGTTGCCGCAGGCGGTCG
GCTTTTCCGCCGCCGAAGCCTTGCTGCCGGACGAGGACGGACTGCACCCCGGTCTGCGTCTTCTGGCCGA
ATACTTCGCCTTCCCGGACAAGTTCGCCTTCTTCGACCTGCCCGTGCAGGCGCCGTCCGGCGCGAGCGAA
GAACTCCAGTTGTACATCGTCTTCGACCGCGCCCCGGCCGGCCGGCTACATCTGCAGGCGGCCGACTTCG
CTCTCGGCTGCGCGCCGCTGGTCAACCTGTTCCCGCGCACCTCGGAGCCGCTGCGCCCGGACGGCACCCG
CAGCGAATACCGGCTGGTCGCCGACAGCCACCGGGAAAACAGCATGGAGATCCACAGCATCCGCGCGCTG
CGCGCCTGCTCGGCAGAGGGCGTGCGCCAGGTGCCGGCCTACCATGGCTGCCAGCACGCCCTCGGCGAGA
GCCGCCTCTACTGGCACGCCCGCCGCGTCGACGGGCTGACGCCGAACCGCCTGGGCAGCGACCTGCTGCT
GAGCCTGGTCGACACCCGTTTCGACCCGCAGCGCGAGGCGCCCGACTACAGCTTGACCGCCGAGCTGCTG
TGCACCAGCCGACACCTCGCCGAGGCTCTGGGCGCCGGTACCCGGCTGGATTTCGAGCGCCCCGGCCCGG
TGGCCCGCGCCCGCCTGCGCAATCCGCCGACGCCGCAAAGCCTGCCGCGCCTGCGCGGCGAATCGCGCTG
GCGGCTGGTCTCGCAACTGAGCCTCAACCACCTGTCGCTGGTGGAGGGAGAACGGGCCCTGGACGCACTC
AAGGAAATGCTCCAGTTGCACAACCTGCGCGACGAGCCCGGCGCGCGCCGGCAGATCGACGGCCTGGTTC
GCCTCGACTGCGAACGCATCGTCGCCCAAGTCGGCGAGGACGCCTGGCGCGGCTGGCGCAACGGCCTGGG
CGTGCGCCTGCATCTCGACCCGCAGCATTTCGTCGGCAGCAGCGCCGTGCTGTTCTCCGCCGTCCTCGCG
CAGTTCTTCTCGCTCTACGCCAGCGCCAATCGCTTCGTGCGCACCACGCTGGTCCTGGCCGACAAGGAGA
TCAAGACGTGGCAGCCACAGGCCGGAATGCCGCTCGTCCTCTGA