SecReT6
Protein ID: 482894212
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50830
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5152981..5153433 [+]
Producthypothetical protein
NoteTssE
UniProt IDM9Y074
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-21, Aligned region: 30..125
Protein Sequence: 150 a.a.     [Download]
>gi|482894212|ref|YP_007895954.1| hypothetical protein AvCA_50830 [Azotobacter vinelandii CA]
MGASGTGIRPPLFERLAATAEDRGSADFDRQALADSVRGELLRLLNTRRGSRPLTTPASVLDYGIADWSA
LQAERSADRRQLSREIRDAILRFEPRLQPGEIELLSIEGQRQRLRVRLNGVLRGGERCWPVSFLIEDGAD
GFEVRHERLD
 
Nucleotide Sequence: 453 bp     [Download]
>gi|482892482|ref|NC_021149.1|:5152981-5153433 Azotobacter vinelandii CA, complete genome
ATGGGCGCCTCCGGCACGGGCATCCGGCCGCCGCTGTTCGAGCGGCTGGCCGCCACGGCGGAAGACCGCG
GCAGCGCGGATTTCGACCGGCAAGCGCTGGCCGACTCGGTGCGCGGCGAGCTGCTGCGGCTACTCAACAC
CCGCCGCGGCTCGCGGCCGCTCACCACCCCGGCGAGCGTGCTCGACTACGGCATCGCCGACTGGAGCGCG
CTGCAGGCCGAACGCAGCGCCGACCGCCGGCAGTTGAGCCGGGAAATCCGCGACGCCATCCTGCGGTTCG
AACCGCGCCTGCAACCGGGCGAAATCGAGCTGCTGTCCATCGAGGGCCAGCGCCAGCGACTGCGCGTGCG
CCTGAACGGCGTCCTGCGCGGCGGGGAGCGGTGCTGGCCGGTGTCGTTCCTGATCGAGGACGGCGCGGAC
GGTTTCGAGGTGCGCCATGAGCGACTCGATTGA