SecReT6
Protein ID: 482894213
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50820
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5152468..5152965 [+]
ProductDUF796 family protein
NoteTssD
UniProt IDM9XX30
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-36, Aligned region: 10..139
Protein Sequence: 165 a.a.     [Download]
>gi|482894213|ref|YP_007895953.1| DUF796 family protein [Azotobacter vinelandii CA]
MDAIILDLGDDIKGDSQIEGYTDKIELMSYSHNVAMQVTNDISNSERTSGKPHIGEFTVTKFVDTSTPSL
NEYCCAGKAIPEVKITVGRNAAESDGKILPFIVYTLNNVVLSNVSVSGGAGGKPVETLSLNFTKIKWELT
AQKNDGSKEGTAASTWDLAANKVVK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|482892482|ref|NC_021149.1|:5152468-5152965 Azotobacter vinelandii CA, complete genome
ATGGATGCGATCATTCTCGACCTCGGCGACGACATCAAAGGCGACAGCCAGATCGAAGGCTACACCGACA
AGATCGAGCTGATGTCCTACAGCCACAACGTGGCCATGCAAGTCACCAACGACATCAGCAACTCGGAGCG
TACCTCCGGCAAGCCGCACATCGGCGAATTCACCGTCACCAAGTTCGTCGATACCTCGACTCCCTCGCTC
AACGAATACTGCTGCGCCGGCAAGGCCATCCCCGAGGTGAAGATCACCGTCGGCCGCAACGCCGCCGAGA
GCGACGGCAAGATCCTGCCCTTCATCGTCTACACCCTGAACAACGTGGTGCTCTCCAACGTCAGCGTCAG
CGGCGGGGCGGGCGGCAAGCCGGTCGAGACGCTGTCGCTCAACTTCACCAAGATCAAGTGGGAGCTGACC
GCGCAGAAGAACGATGGCAGCAAGGAAGGCACGGCCGCCTCGACCTGGGACCTGGCCGCCAACAAGGTCG
TCAAGTAA