SecReT6
Protein ID: 482894215
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50800
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5150313..5150876 [+]
Producthypothetical protein
NoteTssB
UniProt IDM9Y528
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-55, Aligned region: 9..161
Protein Sequence: 187 a.a.     [Download]
>gi|482894215|ref|YP_007895951.1| hypothetical protein AvCA_50800 [Azotobacter vinelandii CA]
MAESTQHKLDRIRPPRVQITYDVETGNAIEKKELPLVVGILADLSGKPEKPLPKLMERRFVEINRDNFND
VLASIAPRAALQVDNTLSQDGSKLNIELHFDHIDDFDPVNIVRQVTPLRRLFEARQRLRDLLTKLDGNDD
LDKLLQDVVANTEGLQEIRSARPQAENPAGAPGAEPAADEPAAEPQA
 
Nucleotide Sequence: 564 bp     [Download]
>gi|482892482|ref|NC_021149.1|:5150313-5150876 Azotobacter vinelandii CA, complete genome
ATGGCCGAGAGTACGCAGCACAAGCTCGACAGGATTCGTCCGCCCCGCGTGCAGATCACGTACGACGTGG
AAACCGGGAACGCCATCGAGAAAAAGGAACTCCCGCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAA
GCCGGAAAAGCCTCTGCCCAAGCTGATGGAACGGCGCTTCGTCGAGATCAATCGCGACAACTTCAACGAC
GTCCTCGCCTCCATCGCTCCCCGCGCCGCCCTGCAGGTCGACAACACCCTGAGCCAGGACGGCAGCAAGC
TGAACATCGAACTGCATTTCGACCACATCGACGACTTCGATCCGGTCAACATCGTCCGGCAGGTGACCCC
GCTGCGCCGGCTGTTCGAGGCGCGCCAGCGCCTGCGCGACCTGCTCACCAAGCTCGACGGCAACGACGAC
CTGGACAAGCTGCTGCAGGACGTCGTGGCCAACACCGAAGGGCTGCAGGAGATCAGGTCGGCCCGTCCGC
AGGCCGAGAACCCGGCGGGCGCGCCCGGCGCCGAGCCGGCCGCCGACGAACCGGCAGCGGAACCGCAAGC
CTGA