SecReT6
Protein ID: 482895837
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50780
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5148257..5149582 [-]
Producthypothetical protein
NoteTssK
UniProt IDM9Y4M6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-68, Aligned region: 20..411
Protein Sequence: 441 a.a.     [Download]
>gi|482895837|ref|YP_007895949.1| hypothetical protein AvCA_50780 [Azotobacter vinelandii CA]
MSVLPEAVCWHEGMQLLPQHFQLQGLRAEALAGHLARVCNPWFWGVETLEVDPAALCAGRVRVTALEATL
PDGLPVGLSADGGAPLELDLAEAFADSAAGVTVYLAVTPLGRAGQLLPLNGRLRSVVGDALPDLASGEHP
EPIVVWRPNPRLVTAEGRADSVCIPLLRVGREGGGYVRLPYVAPMPRILPESPLGEKVRALCARAREKCL
FLAGRLRQARQAGNAEDAAELRLQLAALWARLPEVEAALNGRGTDPATLHRLLAGMAGAWCALDPLAGVP
AFRPLEFEDLLRGYDEVLGWLAATLARIRAGYRSLPFEQDRHGFHILLPDRERPGQRLAIGLRMPAGTGE
QAARDWLAQAIVASEAHVATLVRQRMGGLSWHPMPRQEQVAYGVGEDTRIFVLKAAGEWFDPSQALRIVP
CGGAAGGQPWQIVLFADAGDR
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c5149582-5148257 Azotobacter vinelandii CA, complete genome
ATGAGTGTTCTACCCGAGGCGGTCTGCTGGCACGAGGGCATGCAGTTGCTGCCCCAGCATTTCCAGCTCC
AGGGCTTGCGCGCGGAAGCCCTGGCGGGACACCTGGCCAGGGTCTGCAATCCCTGGTTCTGGGGCGTCGA
GACGCTGGAGGTCGATCCTGCCGCCCTCTGTGCCGGTCGGGTGCGGGTGACCGCCCTCGAAGCCACCCTG
CCGGACGGCCTGCCGGTCGGCCTGAGCGCCGACGGCGGTGCGCCGCTGGAACTGGATCTGGCCGAGGCGT
TCGCCGACTCGGCCGCCGGCGTGACCGTCTACCTCGCCGTGACGCCGCTGGGACGGGCCGGCCAGTTGCT
GCCGCTGAACGGACGCCTGCGCTCGGTGGTCGGTGACGCGCTGCCCGATCTGGCCAGCGGCGAGCATCCC
GAGCCGATCGTCGTCTGGCGGCCGAATCCGCGCCTGGTCACCGCCGAAGGACGGGCCGACTCGGTGTGCA
TTCCCCTGCTGCGAGTGGGGCGGGAGGGCGGCGGCTATGTTCGTTTGCCCTATGTCGCCCCGATGCCGCG
CATCCTCCCGGAGTCGCCGCTGGGCGAAAAGGTGCGGGCCCTGTGCGCCCGCGCCCGGGAGAAGTGCCTG
TTCCTCGCCGGGCGGCTGCGCCAGGCCCGGCAGGCCGGCAACGCCGAAGACGCCGCCGAGCTTCGCCTGC
AACTGGCGGCCCTGTGGGCGCGACTGCCCGAGGTGGAGGCGGCCTTGAACGGACGCGGCACCGATCCGGC
GACCCTGCACCGGCTGCTGGCCGGCATGGCCGGCGCCTGGTGCGCGCTCGATCCGTTGGCCGGCGTCCCG
GCGTTCCGTCCCCTGGAGTTCGAGGACCTGCTGCGCGGCTACGACGAGGTGCTCGGCTGGCTGGCGGCGA
CGCTGGCGCGGATCCGCGCGGGCTACCGGAGCCTGCCGTTCGAGCAGGACCGGCATGGCTTCCATATCCT
CCTGCCGGATCGGGAGCGGCCCGGCCAGCGCCTGGCGATCGGCCTGCGCATGCCGGCCGGGACCGGCGAG
CAGGCGGCCCGGGACTGGCTGGCGCAAGCCATCGTCGCTTCCGAGGCGCATGTCGCGACTCTGGTTCGCC
AGCGCATGGGCGGGCTTTCCTGGCATCCCATGCCCCGGCAGGAACAGGTCGCCTACGGGGTCGGCGAGGA
CACGCGGATCTTCGTGCTCAAGGCGGCCGGCGAGTGGTTCGATCCGAGCCAGGCGCTGCGCATCGTGCCC
TGCGGCGGCGCGGCCGGCGGCCAGCCCTGGCAGATCGTGCTGTTCGCCGACGCCGGCGACCGCTAG