SecReT6
Protein ID: 482895838
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50770
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5147475..5148239 [-]
Producthypothetical protein
NoteTssL
UniProt IDM9Y1J8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.50E-43, Aligned region: 17..228
Protein Sequence: 254 a.a.     [Download]
>gi|482895838|ref|YP_007895948.1| hypothetical protein AvCA_50770 [Azotobacter vinelandii CA]
MLEQEIDPYAPGPGEAPLSSAFGQAWREWLAVRRELEGEEAGEAELVARFAEQAGRIARRLWRTAFAGAG
DAPHQVKEMVYAFVALIDETLLFAPWPGQAAWQEKPLELRLYGSRKAGERIPLAIRKVLAERAPATRDLA
NVYLQCLILGFQGHLRSPRGQALHEKWRHALFDFAWLREPAMSDAVELLGRPAAVAPVRLPVRRSLPDGL
RLGLAILGMAVLLTLLGHLFWRDIAGSLEPVLSVEVALTAERVP
 
Nucleotide Sequence: 765 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c5148239-5147475 Azotobacter vinelandii CA, complete genome
ATGCTCGAGCAGGAGATCGACCCCTATGCGCCGGGTCCCGGCGAGGCGCCCCTGAGTTCCGCCTTTGGCC
AGGCCTGGCGCGAATGGCTGGCCGTCCGGCGCGAGCTGGAGGGCGAGGAGGCCGGCGAGGCCGAACTGGT
CGCGCGCTTCGCCGAACAGGCCGGGCGCATCGCCCGCCGGCTCTGGCGCACGGCCTTCGCCGGCGCCGGC
GACGCGCCGCATCAGGTGAAGGAGATGGTCTACGCTTTCGTCGCCCTGATCGACGAGACGCTGCTGTTCG
CTCCCTGGCCGGGCCAGGCGGCCTGGCAGGAGAAGCCGCTGGAGCTGCGTCTGTACGGTAGCCGCAAGGC
CGGCGAGCGCATCCCGCTGGCGATCAGGAAGGTCCTCGCCGAGCGCGCGCCGGCCACCCGGGACCTTGCC
AACGTCTACCTGCAATGCCTGATCCTCGGCTTCCAGGGCCATCTGCGCAGCCCACGCGGCCAGGCCCTGC
ACGAGAAATGGCGGCATGCGCTGTTCGACTTCGCCTGGCTGCGCGAGCCCGCCATGAGCGATGCGGTCGA
ACTGCTCGGCCGCCCGGCGGCCGTGGCGCCCGTGCGCCTGCCGGTCCGCCGTTCGCTGCCCGACGGCCTG
CGCCTCGGCCTGGCGATCCTGGGCATGGCGGTACTGCTGACGCTGCTCGGCCATCTGTTCTGGCGCGACA
TCGCCGGTTCGCTGGAGCCAGTGCTGTCCGTCGAGGTGGCGCTGACGGCGGAGCGGGTGCCATGA