SecReT6
Protein ID: 482895840
SecReT6 ID754
T6SS typei4a
Gene symbol-
Locus tagAvCA_50750
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]5142553..5143644 [-]
ProductImpA-related protein
NoteTssA
UniProt IDM9Y9J7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.70E-22, Aligned region: 61..121
ImpA-rel_N [PF06812], Evalue: 3.70E-22, Aligned region: 210..237
ImpA-rel_N [PF06812], Evalue: 3.70E-22, Aligned region: 238..257
Protein Sequence: 363 a.a.     [Download]
>gi|482895840|ref|YP_007895946.1| ImpA-related protein [Azotobacter vinelandii CA]
MSSSLSLPLPPDSLLEPLSADSPCGPSLRYDPDFDRLREARREEDASLPSGVWQARIKLGDWATVERLAG
ELLRTRSKDLMVAAWLGEAWLLRRNWEGLPQALALVSGLCERYPDELHPQAEEGDRSWRATPLDWLIRRY
AELSLVRLPLFEPDDESAPFALHDWRQLQLQQVAADDGKAAKAAVEAARQKQRKLDERIRSTPLPVWLRR
RACLEQSACTLERLERWSDEYLGELAPGFAPLRETIRQLIALMQEFIAMHPRASEAAAAPSPAGEAESAS
AAPTVAMPGVATPSGPPGSREQAYRQLGLIADYLARTEPHSPVPYLIRKAMEWGDKPLGDLLSELLSADP
EARRVWTLLGILK
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c5143644-5142553 Azotobacter vinelandii CA, complete genome
TTGAGTTCTTCGCTTTCCCTGCCCTTGCCGCCGGACAGCCTGCTCGAACCGCTCTCGGCGGACTCGCCCT
GCGGTCCGAGCCTGCGCTACGACCCGGATTTCGACCGCCTGCGCGAGGCTCGCCGGGAGGAGGATGCGAG
CCTGCCGAGCGGCGTCTGGCAGGCACGGATCAAACTCGGCGACTGGGCGACGGTAGAGAGGCTGGCCGGC
GAACTGCTGCGCACCCGCAGCAAGGACCTGATGGTGGCCGCCTGGCTGGGCGAGGCCTGGCTGCTGCGCA
GGAACTGGGAAGGGCTGCCCCAGGCGCTGGCGCTGGTGAGCGGTCTGTGCGAACGCTATCCGGACGAGCT
GCACCCGCAGGCCGAGGAGGGCGACCGCTCCTGGCGGGCGACGCCGCTCGACTGGCTGATCCGCCGCTAC
GCCGAGCTGTCGCTGGTCCGCCTGCCGCTGTTCGAGCCGGACGACGAGTCCGCCCCCTTCGCCCTGCACG
ACTGGCGGCAACTGCAGTTGCAGCAGGTCGCCGCCGACGACGGCAAGGCGGCCAAGGCCGCAGTCGAGGC
GGCCCGGCAGAAACAGCGCAAGCTGGACGAGCGGATCAGGAGCACGCCGCTGCCGGTCTGGCTGCGCCGC
CGCGCCTGTCTCGAACAGAGCGCGTGCACGCTGGAGCGTCTGGAGCGCTGGAGCGACGAGTACCTGGGCG
AACTCGCTCCCGGTTTCGCTCCTTTGCGCGAGACCATCCGCCAACTGATCGCCCTGATGCAGGAGTTCAT
CGCCATGCACCCACGAGCATCCGAGGCCGCCGCCGCTCCATCCCCGGCCGGGGAGGCCGAATCGGCCAGC
GCCGCGCCGACCGTCGCCATGCCGGGCGTCGCCACGCCCTCCGGCCCGCCAGGCAGCCGCGAGCAGGCCT
ACCGTCAATTGGGCCTGATCGCCGATTATCTGGCACGTACCGAGCCGCACAGTCCGGTTCCTTACCTGAT
CCGCAAGGCGATGGAGTGGGGCGACAAGCCCCTCGGCGATCTGTTGTCCGAACTGCTGTCGGCGGACCCG
GAGGCCCGGCGCGTCTGGACCCTGCTGGGTATCCTGAAGTGA