SecReT6
Protein ID: 482896638
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26740
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2743188..2743766 [-]
Producthypothetical protein
NoteTssJ
UniProt IDM9Y3W9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.50E-34, Aligned region: 35..170
Protein Sequence: 192 a.a.     [Download]
>gi|482896638|ref|YP_007893635.1| hypothetical protein AvCA_26740 [Azotobacter vinelandii CA]
MLLVLRDFVLPSVTGKFGFLPIGAPVPALLLVSGLLSGCGSTPPPLAPAIPYQLKLNAGGNINPDILGRP
SPIVVRVFELRSGGAFESSDFFSLQDKPELVLGRELIGVEQVTLYPGEVRYVTGAGSPDARNIGILAEYR
ELDAKRWRRLIGLPLPRQSNSWFFWRSSPDRLSLSVDINNDGVDFLPVAHKQ
 
Nucleotide Sequence: 579 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2743766-2743188 Azotobacter vinelandii CA, complete genome
ATGTTGCTTGTGTTGCGTGATTTCGTTTTGCCATCCGTCACGGGAAAGTTCGGATTCCTGCCGATCGGAG
CGCCCGTTCCGGCGCTCCTGCTGGTTTCCGGCCTGCTGTCCGGGTGCGGCTCGACGCCGCCTCCGCTGGC
CCCGGCGATACCCTATCAACTGAAGCTGAATGCCGGCGGAAATATCAATCCCGATATTCTCGGGCGACCG
TCGCCGATTGTGGTGAGAGTGTTCGAGTTGCGTTCGGGCGGTGCCTTCGAATCGAGCGACTTCTTCAGTC
TGCAGGATAAGCCGGAACTTGTCCTGGGCCGGGAGTTGATAGGCGTGGAGCAGGTGACCCTGTATCCCGG
AGAGGTGAGATATGTGACGGGAGCCGGCAGTCCGGATGCGCGGAATATCGGCATCCTGGCCGAATACCGG
GAGTTGGATGCCAAGCGCTGGCGACGCCTGATCGGCTTGCCATTGCCCCGACAGTCGAACTCCTGGTTTT
TCTGGCGAAGTTCGCCGGATCGATTGAGCCTGTCCGTGGATATCAATAACGATGGTGTCGATTTCTTGCC
GGTTGCACATAAACAATGA