SecReT6
Protein ID: 482896640
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26720
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2740550..2741842 [-]
Producthypothetical protein
NoteTssL
UniProt IDM9YBV1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-76, Aligned region: 47..252
DUF2077 [PF09850], Evalue: 1.00E-76, Aligned region: 372..415
OmpA [PF00691], Evalue: 6.00E-15, Aligned region: 316..414
Lipase_GDSL_2 [PF13472], Evalue: 6.30E-05, Aligned region: 131..210
Protein Sequence: 430 a.a.     [Download]
>gi|482896640|ref|YP_007893633.1| hypothetical protein AvCA_26720 [Azotobacter vinelandii CA]
MGDTRMNLHADTFFDPLKPSASPAPERGDDGQEQSATPAQPIVSGGNPLVAAANPLLNLVPQIGGTPQHP
DPPQLRERLLDEIRQFEVRARAAGVPAETVMGARYCLCTTLDEAATLTPWGGGGVWSAHSLLVSFHNETW
GGEKFFQLLARLSQAPQEHIDLLELQYFCLMLGFEGRYRVLDQGRSQLEALKQRLLQLIRKVRGEYPAAL
SPHWHDPVAAPPRVRRSLPVWVGAALAALLCLGLFATFQWLLAGRSDAAFAAIDQLRLPRVLAVAPTPAA
PEPRLAKLLEAEIRDGLVRVSDEVDRSLVVLRGDGLFDSGAAQVIERFQPLLARIGDALNTTRGSVLVMG
YTDNVPIRGLRYASNWELSQARADTVKAQLQARLSDPGRVRAEGRGAADPVAPNDSPANRARNRRVEITL
LVPPGTEARP
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2741842-2740550 Azotobacter vinelandii CA, complete genome
CTGGGCGATACGCGAATGAACCTGCACGCCGATACCTTCTTCGATCCTCTGAAGCCTTCGGCCAGCCCGG
CGCCGGAGCGGGGCGACGACGGCCAGGAGCAGTCCGCCACCCCGGCGCAGCCCATCGTCAGCGGCGGCAA
CCCGCTGGTGGCCGCGGCCAATCCGCTGCTCAATCTGGTGCCGCAGATCGGCGGCACCCCGCAGCATCCC
GACCCGCCGCAACTGCGTGAGCGACTGCTCGACGAAATCCGCCAGTTCGAGGTGCGCGCGCGCGCCGCCG
GCGTGCCGGCGGAGACCGTGATGGGCGCGCGCTACTGCCTGTGCACCACCCTGGACGAGGCCGCCACCCT
GACCCCCTGGGGCGGCGGTGGGGTCTGGTCGGCGCACAGCCTGCTGGTCAGCTTCCACAACGAGACCTGG
GGCGGCGAGAAGTTCTTCCAGTTGCTGGCGCGGCTGTCCCAGGCCCCGCAGGAGCACATCGATCTGCTGG
AGCTGCAGTATTTCTGCTTGATGCTCGGCTTCGAGGGCCGCTACCGGGTGCTGGACCAGGGCCGCTCGCA
GCTCGAAGCGCTCAAGCAGCGCCTGCTGCAGTTGATCCGCAAGGTCCGCGGCGAATATCCGGCCGCGCTT
TCACCGCACTGGCACGATCCGGTCGCGGCGCCGCCCAGGGTGCGCCGCAGCCTGCCGGTCTGGGTCGGCG
CCGCGCTCGCCGCCCTGCTGTGCCTGGGCCTGTTCGCCACCTTCCAGTGGCTGCTGGCCGGCCGTTCGGA
CGCGGCCTTCGCCGCCATCGACCAGTTGCGCCTGCCGCGCGTGCTCGCCGTCGCGCCGACGCCCGCGGCC
CCCGAGCCGCGCCTGGCGAAACTGCTGGAGGCGGAGATCCGCGACGGCCTGGTGCGGGTGAGCGACGAGG
TCGACCGCAGCCTGGTCGTGCTGCGCGGCGACGGCCTGTTCGATTCCGGCGCGGCGCAGGTGATCGAGCG
CTTCCAGCCCCTGCTGGCGCGCATCGGCGACGCCCTGAACACCACCCGCGGCAGCGTGCTGGTGATGGGC
TACACGGACAACGTGCCGATCCGCGGCCTGCGCTACGCCTCCAACTGGGAGCTGTCCCAGGCCCGCGCCG
ATACCGTCAAGGCGCAGTTGCAGGCGCGTCTCTCCGACCCCGGACGGGTGCGCGCCGAAGGGCGGGGCGC
CGCCGACCCGGTGGCGCCCAACGACAGCCCGGCCAATCGCGCACGCAACCGGCGGGTGGAAATCACCCTG
CTGGTGCCCCCCGGAACGGAGGCACGGCCATGA