SecReT6
Protein ID: 482896644
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26680
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2733420..2734454 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDM9YDS5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-22, Aligned region: 58..117
Protein Sequence: 344 a.a.     [Download]
>gi|482896644|ref|YP_007893629.1| ImpA domain-containing protein [Azotobacter vinelandii CA]
MSTSCPEHLLPLLAPVSDERPCGDNLEYAAEFLQLMQAVQPRAEQQYGRTIIPAEEPDWRAVAQQAERLL
ATSKDLRIAVLLSRAWTELRGLAGYADGMRLVAALLDGHWDGLHPLLEEDGETDPLPRHNALSGLFDPQL
CLRALRAAPLAAVGGLTLREVGLLLEGNAPEQLDYPGGRERAQAELARAWEMADPELRAVPEILQALGAI
AERLRASLGEGWLPDSAELEKLLLRLLEASRGTSPAAAAESPSAGDEAAGSASPAAFAPAAVDWRTAELD
SRADVNLLLEKICVYLERHEPSHPAPILLRRAQRLMQLGFYDILRDLAPASLAQIDLLIGKAPS
 
Nucleotide Sequence: 1035 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2734454-2733420 Azotobacter vinelandii CA, complete genome
ATGTCCACGTCATGCCCGGAACATCTGCTTCCCCTGCTGGCCCCGGTGAGCGACGAGCGGCCGTGCGGCG
ACAATCTCGAATACGCGGCGGAGTTCCTGCAGTTGATGCAGGCCGTCCAGCCCAGGGCCGAGCAGCAGTA
TGGCCGCACCATCATCCCGGCCGAAGAGCCGGACTGGCGGGCGGTGGCGCAGCAGGCCGAACGCCTGTTG
GCGACCAGCAAGGACCTGCGCATCGCCGTCCTGCTGAGCCGCGCCTGGACCGAATTGCGCGGGCTGGCCG
GCTACGCCGACGGCATGCGCCTGGTCGCCGCGCTGCTCGACGGCCACTGGGACGGACTGCATCCGCTGCT
CGAGGAGGACGGCGAGACGGACCCCTTGCCGCGCCACAACGCGCTGTCCGGCCTGTTCGACCCGCAGCTC
TGCCTGCGCGCGCTGCGCGCCGCGCCGCTGGCCGCCGTGGGAGGGCTGACGCTGCGCGAGGTCGGCCTGC
TGCTCGAAGGCAACGCCCCGGAGCAGCTCGATTATCCCGGCGGGCGCGAGCGCGCGCAGGCCGAACTGGC
CCGTGCCTGGGAGATGGCCGACCCGGAGCTGCGAGCCGTGCCCGAGATCCTGCAGGCCCTGGGCGCTATC
GCCGAGCGGCTGCGCGCCAGCCTCGGCGAGGGCTGGCTGCCCGACAGCGCCGAGCTGGAAAAACTTCTGC
TGCGCCTGCTGGAGGCCTCCCGCGGCACGTCGCCGGCGGCCGCCGCCGAAAGCCCGTCCGCCGGCGACGA
GGCAGCGGGGAGCGCATCCCCGGCCGCGTTCGCGCCGGCCGCCGTCGACTGGCGCACGGCGGAGCTGGAC
AGCCGCGCCGATGTGAATCTCTTGCTGGAAAAGATCTGCGTCTACCTGGAGCGCCACGAGCCCAGCCATC
CGGCGCCGATTCTGCTGCGCCGCGCGCAGCGGCTCATGCAGCTCGGTTTCTACGACATCCTGCGCGACCT
GGCTCCGGCCAGCCTGGCGCAGATCGATCTGCTGATCGGCAAGGCACCTTCGTGA