SecReT6
Protein ID: 482896645
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26670
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2732778..2733344 [-]
Producthypothetical protein (UCP028301)
NoteTssB
UniProt IDM9YBV3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.40E-60, Aligned region: 18..169
Protein Sequence: 188 a.a.     [Download]
>gi|482896645|ref|YP_007893628.1| hypothetical protein (UCP028301) [Azotobacter vinelandii CA]
MADIRKNSPQKDSGQKFVGRNRSPRVQIEYDVEIYGSDRKVQLPFVMGVMADLTGKQVEPLPELAERKFV
EIDIDNFDDRMESLKPRVAFGVPNTLTGDGQLLVDLTFEQLDDFSPAQVAHKIEPLRKLLEARTQLANLM
SYMDGKTGAEELIAQVLQDPALLETLATNPRVPREADQPVRDEQAQES
 
Nucleotide Sequence: 567 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2733344-2732778 Azotobacter vinelandii CA, complete genome
ATGGCTGATATCCGCAAAAACTCGCCCCAGAAAGACAGCGGTCAGAAGTTCGTCGGACGCAATCGCTCGC
CGCGCGTGCAGATCGAGTACGACGTCGAAATCTACGGCTCGGACCGCAAGGTGCAGCTTCCCTTCGTGAT
GGGCGTCATGGCGGACCTGACCGGCAAGCAGGTCGAGCCCCTGCCGGAACTGGCCGAGCGCAAGTTCGTG
GAAATCGACATCGACAACTTCGACGACCGCATGGAGTCGCTCAAGCCGCGCGTGGCCTTCGGCGTGCCCA
ACACCCTGACCGGCGATGGCCAGTTGCTGGTCGACCTGACCTTCGAGCAACTGGACGACTTTTCCCCGGC
CCAGGTGGCGCACAAGATCGAGCCGCTGCGCAAGCTGCTGGAGGCGCGTACCCAGTTGGCCAACCTGATG
TCCTACATGGACGGCAAGACCGGCGCCGAGGAACTGATCGCCCAGGTACTGCAGGACCCGGCCCTGCTGG
AAACCCTGGCCACCAACCCGAGGGTGCCGCGCGAGGCGGACCAGCCGGTCCGCGACGAGCAGGCGCAGGA
ATCCTGA