SecReT6
Protein ID: 482896646
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26660
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2731262..2732764 [-]
Producthypothetical protein
NoteTssC
UniProt IDM9Y7S7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.60E-194, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|482896646|ref|YP_007893627.1| hypothetical protein AvCA_26660 [Azotobacter vinelandii CA]
MKQIDGALVPGAQLAEYDESEFAALLQKEFRPKTEQARSVVEDAVRTLARQALEQSVGLSGDAYNSIQSI
IAEIDRKLTEQVNLILHHADFQQLEGSWRGLHHLVNNTETDEMLKIRVLPISKKELARNLKRHKGVGWDQ
SPLFKKIYEEEYGQFGGEPYGCLIGDFHFDHSPPDVETLSELARIAAAAHCPVITAAAPSVMQMETWQEL
ANPRDLSKIFQNSEYAAWRALRESEDSRYLALTMPRFLARTPYGSRTNPVDAFDFEEDTDSTNHDRYAWA
NSAYAMGVNINRSFKLYGWCTSIRGVESGGAVENLPYHSFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNTNVAAFIGAQSLQKPAEYMDADATTNARLSARLPYLFACCRFAHYLKCIVRDKIGSFQERGD
IERWLNKWIMTYVDGDPLNSSQLTKARKPLAAAEVRVEEQPDNPGYYAAKFFLRPHYQLEGLTVSLRLVS
KLPSVKGSEA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2732764-2731262 Azotobacter vinelandii CA, complete genome
ATGAAACAGATCGATGGCGCCCTCGTACCGGGCGCGCAGCTTGCCGAATACGACGAAAGCGAATTCGCCG
CGCTGTTGCAGAAGGAGTTCCGGCCCAAGACGGAACAGGCGCGCAGCGTGGTGGAGGACGCCGTGCGCAC
GCTGGCCCGGCAGGCGCTGGAGCAGAGCGTCGGCCTGTCCGGCGACGCCTACAACAGCATCCAGTCCATC
ATCGCGGAAATCGACCGCAAGCTGACCGAACAGGTGAACCTGATCCTGCACCACGCCGACTTCCAGCAAC
TGGAAGGCAGTTGGCGCGGCCTGCATCACCTGGTCAACAACACCGAAACCGACGAGATGCTGAAGATCCG
CGTGCTGCCGATCTCCAAGAAGGAGCTGGCGCGCAATCTCAAGCGGCACAAAGGCGTGGGCTGGGACCAG
AGCCCGCTGTTCAAGAAGATCTACGAAGAGGAATACGGCCAGTTCGGCGGCGAGCCCTACGGCTGCCTGA
TCGGCGATTTCCATTTCGACCACAGCCCGCCGGACGTGGAAACCCTGAGCGAGCTGGCACGCATCGCCGC
CGCCGCGCACTGCCCGGTGATCACCGCGGCAGCGCCATCGGTCATGCAGATGGAAACCTGGCAGGAACTG
GCCAACCCGCGCGACCTGAGCAAGATCTTCCAGAACAGCGAATACGCCGCCTGGCGCGCCCTGCGCGAGT
CGGAGGACTCGCGCTACCTGGCGCTGACCATGCCGCGCTTCCTGGCCCGCACGCCCTACGGCAGTCGCAC
CAACCCGGTGGACGCGTTCGATTTCGAGGAAGACACCGACAGCACCAACCACGACCGCTACGCCTGGGCC
AACTCGGCCTACGCGATGGGCGTGAACATCAACCGCTCGTTCAAGCTCTACGGCTGGTGTACCTCGATCC
GCGGCGTGGAAAGCGGCGGGGCGGTGGAAAACCTGCCGTACCACAGTTTTCCCACCGACGACGGCGGGGT
GGACATGAAATGTCCCACCGAGATCGCCATCAGCGACCGCCGCGAGGCGGAACTGGCCAAGAACGGTTTC
ATGCCGCTGGTCCACCGCAAGAACACCAACGTCGCCGCTTTCATCGGCGCCCAGTCGCTGCAGAAACCCG
CCGAATACATGGATGCCGACGCCACCACCAACGCCCGGCTGTCGGCGCGCCTGCCCTATCTGTTCGCCTG
CTGCCGCTTCGCGCATTACCTCAAGTGCATCGTGCGCGACAAGATCGGTTCCTTCCAGGAGCGCGGCGAC
ATCGAGCGCTGGCTCAACAAATGGATCATGACCTATGTGGACGGCGATCCGCTCAATTCCTCGCAACTGA
CCAAGGCCAGGAAGCCCCTGGCCGCCGCCGAGGTGCGCGTCGAGGAGCAGCCGGACAACCCGGGCTACTA
CGCGGCCAAGTTCTTCCTGCGTCCCCACTACCAGCTCGAAGGGTTGACCGTGTCCCTGCGGCTGGTCTCG
AAACTGCCGTCGGTGAAGGGCAGCGAAGCCTGA