SecReT6
Protein ID: 482896647
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26650
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2730721..2731203 [-]
Producthypothetical protein
NoteTssD
UniProt IDM9Y728
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-27, Aligned region: 2..125
Protein Sequence: 160 a.a.     [Download]
>gi|482896647|ref|YP_007893626.1| hypothetical protein AvCA_26650 [Azotobacter vinelandii CA]
MHLKIEGVQGESQESQHAAWLDIKSFTWGISQPGSLDSGGGGTPGRASFTDLHVVSYVEASAPTAFKKCA
NGTSLGTVELSCSRLSDGDKMVFMTITLTNVLVTKADIKGVDRDDEQERLLIEYAFQAPEVEFGYTPQQD
DGSAGGEVTMGWNIPQNTEL
 
Nucleotide Sequence: 483 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2731203-2730721 Azotobacter vinelandii CA, complete genome
ATGCACCTGAAGATCGAGGGCGTCCAGGGCGAGTCCCAGGAGTCCCAACACGCTGCCTGGCTCGACATCA
AGTCGTTCACCTGGGGAATCAGCCAGCCCGGCTCCCTGGATTCCGGCGGCGGCGGCACCCCCGGCCGGGC
CAGCTTCACCGACCTGCACGTGGTTTCCTACGTGGAGGCCTCCGCGCCGACCGCGTTCAAGAAGTGCGCC
AACGGCACCAGCCTGGGAACGGTGGAACTGTCCTGCTCCCGGCTCTCCGACGGCGACAAGATGGTCTTCA
TGACCATCACCCTGACCAACGTGCTGGTCACCAAGGCGGACATCAAGGGCGTCGACAGGGACGACGAGCA
GGAGCGCCTGCTCATCGAGTACGCCTTCCAGGCCCCCGAGGTGGAATTCGGCTACACGCCCCAGCAGGAC
GACGGCAGCGCGGGCGGCGAGGTCACCATGGGCTGGAACATCCCCCAGAACACCGAGCTCTGA