SecReT6
Protein ID: 482896648
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26640
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2730076..2730618 [-]
Producthypothetical protein
NoteTssE
UniProt IDM9Y3X7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.30E-21, Aligned region: 48..159
Protein Sequence: 180 a.a.     [Download]
>gi|482896648|ref|YP_007893625.1| hypothetical protein AvCA_26640 [Azotobacter vinelandii CA]
MADPLHTPRDRRQARGKRDRLRPALLDRLTDDEPLQRTEPLTPGASTGELRAAVLRDLAWLFNTISMAAD
LDLAPFGEAQRSVLNYGVLPLAGKRISELDCQELASRLRLAILRFEPRLLPDSVEVLHIDEPDKRLMHHN
ELVFEIRARLWSAPYPVEFRVRSELDLESGQSLLHDLAID
 
Nucleotide Sequence: 543 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2730618-2730076 Azotobacter vinelandii CA, complete genome
ATGGCTGATCCGCTGCACACGCCCAGGGACAGGCGGCAAGCGCGCGGCAAGCGCGACCGCCTGCGCCCGG
CGCTGCTCGACCGTCTGACCGACGACGAGCCCCTGCAACGCACGGAACCCCTGACGCCGGGCGCCAGCAC
CGGCGAGTTGCGCGCCGCGGTGCTGCGCGACCTGGCCTGGCTGTTCAACACCATCAGCATGGCCGCCGAC
CTGGATCTGGCGCCGTTCGGCGAAGCGCAGCGCTCGGTGCTGAACTACGGCGTGCTGCCGCTGGCCGGCA
AGCGCATTTCCGAGCTGGACTGCCAGGAACTCGCCTCCCGGCTGCGCCTGGCCATCCTGCGCTTCGAACC
GCGCCTGCTGCCGGACAGCGTCGAGGTGCTGCACATCGACGAGCCGGACAAGCGGCTCATGCACCACAAC
GAACTGGTCTTCGAGATCCGCGCCCGGCTCTGGTCGGCGCCGTACCCGGTGGAATTCCGCGTGCGTTCCG
AACTGGATCTGGAAAGCGGCCAATCCCTGTTGCACGACCTGGCGATCGACTGA