SecReT6
Protein ID: 482896650
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26620
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2727177..2728190 [-]
Producthypothetical protein
NoteTssG
UniProt IDM9YBV6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-110, Aligned region: 10..314
Protein Sequence: 337 a.a.     [Download]
>gi|482896650|ref|YP_007893623.1| hypothetical protein AvCA_26620 [Azotobacter vinelandii CA]
MDAPLWQALRAEPHAHDLFQVLRWLDARAGLPVPLGRAARPQDEPLRLGQRPSLSFAPSMIAGLDETLER
PPYLSIFGFGLFGPHGPLPLHLTEYAHDRERMAGDPTLAAFADLFHHRLILLFYRAWADAQPTVGLDRPG
ANRFEDYIACLLGRGLEAQRDAEPLGRHAIYHQAGHLLRQTRNPEGLQRILSGYFGIPVRIVEYVAHWVA
LEPDARLALGRSGENMGLGTGATLGCAVRDAQSRFRLVLGPMGWADYRRFLPGGDRVPALLHWLREYVGL
ELAWDAQLILAADQVRGTALGEPRPLGLGTWLGRRPADAGDAGDLIIDYSHLGESHV
 
Nucleotide Sequence: 1014 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2728190-2727177 Azotobacter vinelandii CA, complete genome
ATGGACGCTCCGCTGTGGCAGGCGCTGCGCGCCGAGCCGCATGCCCACGACCTGTTCCAGGTGCTGCGCT
GGCTGGATGCCCGCGCCGGCCTGCCGGTCCCGCTGGGACGCGCCGCGCGGCCGCAGGACGAGCCGCTGCG
CCTGGGCCAGCGGCCCTCGCTGTCGTTCGCGCCGTCGATGATCGCCGGTCTGGACGAAACGCTGGAGCGG
CCGCCGTACCTGTCGATCTTCGGCTTCGGCCTGTTCGGCCCCCACGGCCCGCTGCCGCTGCACCTGACCG
AATACGCCCACGACCGCGAGCGCATGGCGGGCGACCCGACCCTGGCCGCCTTCGCCGATCTTTTCCATCA
CCGGCTGATCCTGCTGTTCTACCGCGCCTGGGCCGACGCGCAGCCCACCGTCGGCCTCGACCGCCCCGGC
GCCAACCGCTTCGAGGACTACATCGCCTGCCTGCTGGGCCGGGGGCTGGAGGCGCAACGGGACGCCGAGC
CGCTGGGACGCCACGCCATTTACCACCAGGCCGGCCACCTGCTGCGGCAGACGCGCAACCCGGAAGGCCT
GCAACGGATTCTGAGCGGCTATTTCGGGATACCGGTGCGCATCGTCGAGTACGTGGCGCACTGGGTGGCG
CTGGAGCCGGACGCCCGCCTGGCCCTGGGCCGCAGCGGCGAGAACATGGGCCTGGGCACGGGCGCGACCC
TGGGCTGCGCGGTGCGCGACGCCCAGTCGCGTTTCCGCCTGGTCCTCGGGCCGATGGGCTGGGCGGACTA
CCGCCGTTTTCTGCCCGGCGGCGACCGGGTGCCGGCCCTGCTGCACTGGCTGCGCGAATACGTCGGGCTG
GAACTGGCCTGGGACGCGCAACTGATCCTGGCCGCCGACCAGGTGCGCGGCACCGCCCTCGGCGAGCCGC
GCCCGCTGGGCCTGGGCACCTGGCTCGGCCGGCGGCCGGCGGATGCCGGCGACGCCGGCGATCTGATCAT
CGATTACAGCCACCTGGGGGAGTCCCATGTCTGA