SecReT6
Protein ID: 482896652
SecReT6 ID753
T6SS typei3
Gene symbol-
Locus tagAvCA_26600
StrainAzotobacter vinelandii CA
Repliconchromosome [GenBank: NC_021149] [Browse all T6SS(s) in this replicon]
Location [Strand]2722456..2724519 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDM9Y731
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-81, Aligned region: 24..328
Phage_GPD [PF05954], Evalue: 4.80E-81, Aligned region: 617..672
Phage_base_V [PF04717], Evalue: 1.20E-24, Aligned region: 366..458
Protein Sequence: 687 a.a.     [Download]
>gi|482896652|ref|YP_007893621.1| Rhs element Vgr protein [Azotobacter vinelandii CA]
MDRNVKVHSVLGEDVLLFRAMTGTETLSQLFRFEVELLAESHSLSLKTLLGSALTLEIATRDEGVRYLNG
LVTRCELFGREDRTARLYRYRATVRPWLWLLSRNRDCRIFQEQSVPEIVQAIFAKYSSLTVELSLTGTYR
QWGYCVQYQESDFSFVSRLLEHEGIYYYFRHELGSHTLVLVDDIETHETFAGYESIPFFAADRLVAVQEE
CIDIYRVSEEMASGSYIGDDYNFTAPKSLMRALLSNPAEHEHSDAEVYEWLTGYRDYGEAAHYTRIRLEE
LQTRRELDEGHAIARGLAPGYRFTLRNCPREEANRDYLVVSVTYHLKEPGYASNPEPARYDFDFVTQPVS
LPFRPRRITPKPRPHGPQTAVVVGPEGEEIWTDEYGRVKVQFHWDRYGQMNEESSCWIRVASSWAGSTFG
GIYIPRIGQEVIVDFIGGEIDRPIVIGSTYNADQMPPFELPLNSSQSGIVTRTLEGTPVNGNFFYFEDRA
GEELVRIKAERDHDTEVLNDTNHFTVKTHSLTVGDLEIAVGDDGGGATSNTINQPLSVAGGGNFNVRTVN
ITIRSAVNIDISAIKVGVAGVNTSLDGVKVAIVGVNTVYNGATFIRNETIKKEHNFYKSESTHLEHKESH
AVEEKGTLRRIRYNLVNFSSGTFRADYQKKKDDAKQKARDELKKKIGSPQLPPGTAI
 
Nucleotide Sequence: 2064 bp     [Download]
>gi|482892482|ref|NC_021149.1|:c2724519-2722456 Azotobacter vinelandii CA, complete genome
ATGGATCGTAACGTCAAGGTACACAGCGTGTTGGGCGAGGACGTGCTGCTGTTTCGCGCCATGACCGGCA
CGGAAACGCTGTCGCAGCTCTTCCGGTTCGAAGTCGAACTGCTCGCGGAAAGCCATTCGCTGTCGCTGAA
AACGCTGCTGGGCAGCGCGCTGACCCTGGAAATCGCCACCCGGGACGAGGGGGTGCGCTACCTCAACGGC
CTGGTCACCCGCTGCGAGCTGTTCGGCCGCGAGGACCGCACCGCGCGGCTGTACCGCTACCGCGCCACCG
TCCGCCCCTGGCTGTGGCTGCTCAGCCGCAACCGCGACTGCCGGATCTTCCAGGAGCAGAGCGTCCCGGA
GATCGTGCAGGCGATCTTCGCCAAGTACAGCAGTCTGACCGTCGAACTGTCGCTCACCGGCACCTACCGC
CAGTGGGGCTACTGCGTGCAGTACCAGGAAAGCGACTTCAGCTTCGTTTCCCGGCTGCTGGAGCACGAGG
GCATCTACTACTACTTCCGGCACGAACTGGGCAGCCACACCCTGGTGCTGGTGGACGACATCGAGACGCA
CGAAACCTTCGCCGGTTACGAGAGCATTCCCTTCTTCGCCGCCGACCGCCTGGTGGCGGTGCAGGAGGAG
TGCATCGACATCTACCGGGTCAGCGAAGAGATGGCGTCGGGCAGCTATATCGGCGACGACTACAACTTCA
CCGCGCCGAAGAGCCTGATGCGCGCCCTGCTCAGCAATCCGGCGGAACACGAACACAGCGACGCCGAAGT
CTACGAATGGCTGACCGGCTACCGGGACTACGGCGAGGCGGCCCACTACACGCGCATCCGCCTGGAGGAA
CTGCAGACCCGCCGCGAACTCGACGAAGGCCACGCCATCGCGCGCGGCCTGGCGCCGGGCTACCGCTTCA
CCCTGCGCAACTGCCCGCGGGAAGAAGCCAACCGCGACTACCTGGTGGTGAGCGTCACCTACCACCTCAA
GGAGCCGGGCTACGCCAGCAACCCCGAACCGGCCCGCTACGACTTCGACTTCGTCACCCAGCCGGTCAGC
CTGCCGTTCCGCCCGCGGCGGATCACGCCCAAGCCCCGTCCCCACGGCCCGCAGACCGCCGTGGTGGTGG
GGCCCGAGGGCGAGGAGATCTGGACCGACGAATACGGCCGGGTCAAGGTGCAGTTCCACTGGGACCGCTA
CGGCCAGATGAACGAGGAAAGTTCCTGCTGGATCAGGGTGGCCAGCAGCTGGGCCGGCTCGACCTTCGGC
GGCATCTACATCCCGCGGATCGGCCAGGAGGTGATCGTCGACTTCATCGGCGGCGAAATCGACCGGCCGA
TCGTGATCGGCAGCACCTACAACGCCGACCAGATGCCGCCCTTCGAACTGCCGCTGAACTCCAGCCAGAG
CGGTATCGTCACCCGCACGCTGGAGGGAACCCCGGTCAACGGCAATTTCTTTTACTTCGAGGACCGGGCG
GGGGAGGAACTGGTCCGTATCAAGGCCGAACGCGATCACGATACCGAAGTGCTGAACGATACCAATCACT
TCACCGTCAAGACCCACAGCCTGACGGTGGGCGATCTCGAAATCGCGGTCGGCGACGATGGCGGGGGCGC
CACGAGCAATACCATCAACCAACCCCTGAGCGTCGCCGGAGGCGGGAACTTCAACGTGCGGACCGTCAAT
ATCACGATCCGCTCGGCCGTGAATATCGATATTTCCGCGATAAAGGTGGGCGTAGCCGGAGTCAATACGA
GTCTGGATGGAGTGAAGGTTGCCATTGTCGGGGTCAATACGGTTTATAACGGTGCGACTTTCATTCGCAA
TGAGACGATAAAAAAGGAGCACAACTTCTATAAGTCAGAGTCGACGCACCTCGAACACAAAGAGTCGCAT
GCCGTTGAGGAAAAAGGCACGCTTCGCCGGATTCGTTACAATCTCGTGAATTTCAGCAGTGGAACCTTCA
GGGCGGATTATCAAAAGAAAAAGGACGATGCGAAGCAAAAGGCGCGGGATGAGCTTAAAAAGAAAATAGG
GTCGCCGCAATTGCCGCCAGGAACGGCGATATAG