SecReT6
Protein ID: 482902447
SecReT6 ID756
T6SS typei4a
Gene symbol-
Locus tagAvCA6_50770
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]5104315..5105079 [-]
Producthypothetical protein
NoteTssL
UniProt IDM9YP08
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.50E-43, Aligned region: 17..228
Protein Sequence: 254 a.a.     [Download]
>gi|482902447|ref|YP_007900954.1| hypothetical protein AvCA6_50770 [Azotobacter vinelandii CA6]
MLEQEIDPYAPGPGEAPLSSAFGQAWREWLAVRRELEGEEAGEAELVARFAEQAGRIARRLWRTAFAGAG
DAPHQVKEMVYAFVALIDETLLFAPWPGQAAWQEKPLELRLYGSRKAGERIPLAIRKVLAERAPATRDLA
NVYLQCLILGFQGHLRSPRGQALHEKWRHALFDFAWLREPAMSDAVELLGRPAAVAPVRLPVRRSLPDGL
RLGLAILGMAVLLTLLGHLFWRDIAGSLEPVLSVEVALTAERVP
 
Nucleotide Sequence: 765 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c5105079-5104315 Azotobacter vinelandii CA6, complete genome
ATGCTCGAGCAGGAGATCGACCCCTATGCGCCGGGTCCCGGCGAGGCGCCCCTGAGTTCCGCCTTTGGCC
AGGCCTGGCGCGAATGGCTGGCCGTCCGGCGCGAGCTGGAGGGCGAGGAGGCCGGCGAGGCCGAACTGGT
CGCGCGCTTCGCCGAACAGGCCGGGCGCATCGCCCGCCGGCTCTGGCGCACGGCCTTCGCCGGCGCCGGC
GACGCGCCGCATCAGGTGAAGGAGATGGTCTACGCTTTCGTCGCCCTGATCGACGAGACGCTGCTGTTCG
CTCCCTGGCCGGGCCAGGCGGCCTGGCAGGAGAAGCCGCTGGAGCTGCGTCTGTACGGTAGCCGCAAGGC
CGGCGAGCGCATCCCGCTGGCGATCAGGAAGGTCCTCGCCGAGCGCGCGCCGGCCACCCGGGACCTTGCC
AACGTCTACCTGCAATGCCTGATCCTCGGCTTCCAGGGCCATCTGCGCAGCCCACGCGGCCAGGCCCTGC
ACGAGAAATGGCGGCATGCGCTGTTCGACTTCGCCTGGCTGCGCGAGCCCGCCATGAGCGATGCGGTCGA
ACTGCTCGGCCGCCCGGCGGCCGTGGCGCCCGTGCGCCTGCCGGTCCGCCGTTCGCTGCCCGACGGCCTG
CGCCTCGGCCTGGCGATCCTGGGCATGGCGGTACTGCTGACGCTGCTCGGCCATCTGTTCTGGCGCGACA
TCGCCGGTTCGCTGGAGCCAGTGCTGTCCGTCGAGGTGGCGCTGACGGCGGAGCGGGTGCCATGA