SecReT6
Protein ID: 482902448
SecReT6 ID756
T6SS typei4a
Gene symbol-
Locus tagAvCA6_50780
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]5105097..5106422 [-]
Producthypothetical protein
NoteTssK
UniProt IDM9YNE2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-68, Aligned region: 20..411
Protein Sequence: 441 a.a.     [Download]
>gi|482902448|ref|YP_007900955.1| hypothetical protein AvCA6_50780 [Azotobacter vinelandii CA6]
MSVLPEAVCWHEGMQLLPQHFQLQGLRAEALAGHLARVCNPWFWGVETLEVDPAALCAGRVRVTALEATL
PDGLPVGLSADGGAPLELDLAEAFADSAAGVTVYLAVTPLGRAGQLLPLNGRLRSVVGDALPDLASGEHP
EPIVVWRPNPRLVTAEGRADSVCIPLLRVGREGGGYVRLPYVAPMPRILPESPLGEKVRALCARAREKCL
FLAGRLRQARQAGNAEDAAELRLQLAALWARLPEVEAALNGRGTDPATLHRLLAGMAGAWCALDPLAGVP
AFRPLEFEDLLRGYDEVLGWLAATLARIRAGYRSLPFEQDRHGFHILLPDRERPGQRLAIGLRMPAGTGE
QAARDWLAQAIVASEAHVATLVRQRMGGLSWHPMPRQEQVAYGVGEDTRIFVLKAAGEWFDPSQALRIVP
CGGAAGGQPWQIVLFADAGDR
 
Nucleotide Sequence: 1326 bp     [Download]
>gi|482897536|ref|NC_021150.1|:c5106422-5105097 Azotobacter vinelandii CA6, complete genome
ATGAGTGTTCTACCCGAGGCGGTCTGCTGGCACGAGGGCATGCAGTTGCTGCCCCAGCATTTCCAGCTCC
AGGGCTTGCGCGCGGAAGCCCTGGCGGGACACCTGGCCAGGGTCTGCAATCCCTGGTTCTGGGGCGTCGA
GACGCTGGAGGTCGATCCTGCCGCCCTCTGTGCCGGTCGGGTGCGGGTGACCGCCCTCGAAGCCACCCTG
CCGGACGGCCTGCCGGTCGGCCTGAGCGCCGACGGCGGTGCGCCGCTGGAACTGGATCTGGCCGAGGCGT
TCGCCGACTCGGCCGCCGGCGTGACCGTCTACCTCGCCGTGACGCCGCTGGGACGGGCCGGCCAGTTGCT
GCCGCTGAACGGACGCCTGCGCTCGGTGGTCGGTGACGCGCTGCCCGATCTGGCCAGCGGCGAGCATCCC
GAGCCGATCGTCGTCTGGCGGCCGAATCCGCGCCTGGTCACCGCCGAAGGACGGGCCGACTCGGTGTGCA
TTCCCCTGCTGCGAGTGGGGCGGGAGGGCGGCGGCTATGTTCGTTTGCCCTATGTCGCCCCGATGCCGCG
CATCCTCCCGGAGTCGCCGCTGGGCGAAAAGGTGCGGGCCCTGTGCGCCCGCGCCCGGGAGAAGTGCCTG
TTCCTCGCCGGGCGGCTGCGCCAGGCCCGGCAGGCCGGCAACGCCGAAGACGCCGCCGAGCTTCGCCTGC
AACTGGCGGCCCTGTGGGCGCGACTGCCCGAGGTGGAGGCGGCCTTGAACGGACGCGGCACCGATCCGGC
GACCCTGCACCGGCTGCTGGCCGGCATGGCCGGCGCCTGGTGCGCGCTCGATCCGTTGGCCGGCGTCCCG
GCGTTCCGTCCCCTGGAGTTCGAGGACCTGCTGCGCGGCTACGACGAGGTGCTCGGCTGGCTGGCGGCGA
CGCTGGCGCGGATCCGCGCGGGCTACCGGAGCCTGCCGTTCGAGCAGGACCGGCATGGCTTCCATATCCT
CCTGCCGGATCGGGAGCGGCCCGGCCAGCGCCTGGCGATCGGCCTGCGCATGCCGGCCGGGACCGGCGAG
CAGGCGGCCCGGGACTGGCTGGCGCAAGCCATCGTCGCTTCCGAGGCGCATGTCGCGACTCTGGTTCGCC
AGCGCATGGGCGGGCTTTCCTGGCATCCCATGCCCCGGCAGGAACAGGTCGCCTACGGGGTCGGCGAGGA
CACGCGGATCTTCGTGCTCAAGGCGGCCGGCGAGTGGTTCGATCCGAGCCAGGCGCTGCGCATCGTGCCC
TGCGGCGGCGCGGCCGGCGGCCAGCCCTGGCAGATCGTGCTGTTCGCCGACGCCGGCGACCGCTAG