SecReT6
Protein ID: 482902450
SecReT6 ID756
T6SS typei4a
Gene symbol-
Locus tagAvCA6_50800
StrainAzotobacter vinelandii CA6
Repliconchromosome [GenBank: NC_021150] [Browse all T6SS(s) in this replicon]
Location [Strand]5107153..5107716 [+]
Producthypothetical protein
NoteTssB
UniProt IDM9YVC0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-55, Aligned region: 9..161
Protein Sequence: 187 a.a.     [Download]
>gi|482902450|ref|YP_007900957.1| hypothetical protein AvCA6_50800 [Azotobacter vinelandii CA6]
MAESTQHKLDRIRPPRVQITYDVETGNAIEKKELPLVVGILADLSGKPEKPLPKLMERRFVEINRDNFND
VLASIAPRAALQVDNTLSQDGSKLNIELHFDHIDDFDPVNIVRQVTPLRRLFEARQRLRDLLTKLDGNDD
LDKLLQDVVANTEGLQEIRSARPQAENPAGAPGAEPAADEPAAEPQA
 
Nucleotide Sequence: 564 bp     [Download]
>gi|482897536|ref|NC_021150.1|:5107153-5107716 Azotobacter vinelandii CA6, complete genome
ATGGCCGAGAGTACGCAGCACAAGCTCGACAGGATTCGTCCGCCCCGCGTGCAGATCACGTACGACGTGG
AAACCGGGAACGCCATCGAGAAAAAGGAACTCCCGCTGGTGGTCGGCATCCTCGCCGACCTCTCCGGCAA
GCCGGAAAAGCCTCTGCCCAAGCTGATGGAACGGCGCTTCGTCGAGATCAATCGCGACAACTTCAACGAC
GTCCTCGCCTCCATCGCTCCCCGCGCCGCCCTGCAGGTCGACAACACCCTGAGCCAGGACGGCAGCAAGC
TGAACATCGAACTGCATTTCGACCACATCGACGACTTCGATCCGGTCAACATCGTCCGGCAGGTGACCCC
GCTGCGCCGGCTGTTCGAGGCGCGCCAGCGCCTGCGCGACCTGCTCACCAAGCTCGACGGCAACGACGAC
CTGGACAAGCTGCTGCAGGACGTCGTGGCCAACACCGAAGGGCTGCAGGAGATCAGGTCGGCCCGTCCGC
AGGCCGAGAACCCGGCGGGCGCGCCCGGCGCCGAGCCGGCCGCCGACGAACCGGCAGCGGAACCGCAAGC
CTGA